KEGG   Helicobacter pylori Aklavik86: HPAKL86_01775Help
Entry
HPAKL86_01775     CDS       T02353                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hpyk  Helicobacter pylori Aklavik86
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hpyk00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(348141..348779)
Genome map
AA seq 212 aa AA seqDB search
MSNMNTHTRGIDSNLIYSLKSISLSMFRKGFFGLYQGSISARIGTNQFVINKRNAVFDQL
NENTLLVLHDKMDYRWKEASLDSPIHASVYREFLDAKFIAYARPPYSLAYSLRHNRLLPK
DYLGYRSLGEEISIFNPKDYDSWQERADTEILRQLQESKKYFVFIKGCGIFAYHRELSKL
MEVFDLIENSCKVLRLGDLMDYCYNDDPRLSV
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacatgaacacacacacaagaggcattgacagcaatctgatttattcgctcaaa
agcatttcattatccatgtttagaaagggtttttttgggctatatcaaggctctatttca
gcgcgcattggcacgaatcaatttgtgatcaataaaagaaacgctgtttttgatcaactg
aatgaaaacaccttactggttttgcatgacaagatggattatcgctggaaagaagcgagt
ctggattcgcccattcatgcgagcgtgtatagggagtttttggacgctaaattcatcgct
tatgcgcgccctccttatagtttggcgtattccttgcgccacaaccgattgctccctaaa
gattatttagggtatcgttctttgggcgaagaaatttccatttttaaccccaaagactat
gacagctggcaagaaagagcggatacagaaattttacgccaactgcaagagagcaaaaaa
tattttgtcttcattaaggggtgcgggatttttgcctaccacagggagctttctaaactc
atggaagtttttgatttgattgaaaactcatgcaaggttttacgactgggcgatttaatg
gattattgctataatgatgatccacgattgagcgtgtaa

DBGET integrated database retrieval system