KEGG   Helicobacter pylori Aklavik86: HPAKL86_05735Help
Entry
HPAKL86_05735     CDS       T02353                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
hpyk  Helicobacter pylori Aklavik86
Pathway
hpyk00010  Glycolysis / Gluconeogenesis
hpyk00052  Galactose metabolism
hpyk00500  Starch and sucrose metabolism
hpyk00520  Amino sugar and nucleotide sugar metabolism
hpyk00521  Streptomycin biosynthesis
hpyk01100  Metabolic pathways
hpyk01110  Biosynthesis of secondary metabolites
hpyk01120  Microbial metabolism in diverse environments
hpyk01130  Biosynthesis of antibiotics
hpyk01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hpyk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPAKL86_05735 (glk)
   00052 Galactose metabolism
    HPAKL86_05735 (glk)
   00500 Starch and sucrose metabolism
    HPAKL86_05735 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    HPAKL86_05735 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HPAKL86_05735 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    HPAKL86_05735 (glk)
Enzymes [BR:hpyk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HPAKL86_05735 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: AFX90137
UniProt: K7YPB0
Position
1207677..1208687
Genome map
AA seq 336 aa AA seqDB search
MPKTETYPRLLADIGGTNARFGLEVAPRQIECIEVLPCKDFESLSDAVRFYLSKCKESLK
LRPIYGSFAVATPIMGDFVQMTNNHWTFSIETTRQCLDLKKLLVINDFVAQAYAISAMQE
NDLAQIGGIKCEINAPKAILGPGTGLGVSTLIQNSDGSLKVLPGEGGHVSFAPFDDLEIL
VWQYARSKFNHVSAERFLSGSGLVLIYEALSKRKGLEKAAKLSKAELTPQIISERALNGD
YPICRLTLDTFCSMLGTLAADVALTLGARGGVYLCGGIIPRFIDYFKTSPFRARFETKGR
MGAFLASIPVHVVLKKTPGLNGAGIALENYLLHDKI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaactgaaacttacccaagactattagccgatattggcggcacgaacgcgcgc
tttggcttggaagtcgccccacgacagattgaatgcattgaagttttgccatgcaaagat
tttgaaagcttgagcgatgcggtgcgattctatctttctaaatgcaaagaaagccttaaa
ctgcgccctatttatggctcttttgcggtggctacgcccattatgggggattttgtccaa
atgactaacaaccactggactttttctattgaaacgacacggcaatgtttggatttaaaa
aaattgcttgtcatcaatgattttgtcgcgcaagcctatgccattagcgcgatgcaagaa
aacgatctggctcaaataggcgggattaagtgcgaaatcaacgctcctaaagcgatttta
gggccaggaactgggcttggggtaagcactcttatccaaaacagcgatggctctttgaaa
gtcttgcccggtgaaggggggcatgtgagtttcgccccttttgatgatttagaaatttta
gtgtggcaatacgcccgctctaaattcaaccatgtgagcgcggaaaggtttttgagcggg
agcggtttggtgctgatttatgaagccctgtctaagcgcaaaggcttagaaaaagcagca
aagttaagcaaggctgaattaaccccacaaatcattagcgaacgcgctttgaatggggat
taccctatatgccgattgactttggacactttttgctccatgctaggcacgcttgctgct
gatgtggctctcactttgggggctagagggggcgtgtatttgtgtggggggattatccca
cgattcattgattattttaaaacttcgccctttagagcgcgttttgaaacgaaagggcgc
atgggagcgtttctcgcttctatccctgtgcatgtcgtgctgaaaaaaaccccgggactt
aatggggcgggcattgcgttagagaattatttactgcatgataagatatag

DBGET integrated database retrieval system