KEGG   Helicobacter pylori Aklavik86: HPAKL86_05735Help
Entry
HPAKL86_05735     CDS       T02353                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
hpyk  Helicobacter pylori Aklavik86
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:hpyk01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hpyk00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:hpyk00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:hpyk00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:hpyk00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:hpyk00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1207677..1208687
Genome map
AA seq 336 aa AA seqDB search
MPKTETYPRLLADIGGTNARFGLEVAPRQIECIEVLPCKDFESLSDAVRFYLSKCKESLK
LRPIYGSFAVATPIMGDFVQMTNNHWTFSIETTRQCLDLKKLLVINDFVAQAYAISAMQE
NDLAQIGGIKCEINAPKAILGPGTGLGVSTLIQNSDGSLKVLPGEGGHVSFAPFDDLEIL
VWQYARSKFNHVSAERFLSGSGLVLIYEALSKRKGLEKAAKLSKAELTPQIISERALNGD
YPICRLTLDTFCSMLGTLAADVALTLGARGGVYLCGGIIPRFIDYFKTSPFRARFETKGR
MGAFLASIPVHVVLKKTPGLNGAGIALENYLLHDKI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaactgaaacttacccaagactattagccgatattggcggcacgaacgcgcgc
tttggcttggaagtcgccccacgacagattgaatgcattgaagttttgccatgcaaagat
tttgaaagcttgagcgatgcggtgcgattctatctttctaaatgcaaagaaagccttaaa
ctgcgccctatttatggctcttttgcggtggctacgcccattatgggggattttgtccaa
atgactaacaaccactggactttttctattgaaacgacacggcaatgtttggatttaaaa
aaattgcttgtcatcaatgattttgtcgcgcaagcctatgccattagcgcgatgcaagaa
aacgatctggctcaaataggcgggattaagtgcgaaatcaacgctcctaaagcgatttta
gggccaggaactgggcttggggtaagcactcttatccaaaacagcgatggctctttgaaa
gtcttgcccggtgaaggggggcatgtgagtttcgccccttttgatgatttagaaatttta
gtgtggcaatacgcccgctctaaattcaaccatgtgagcgcggaaaggtttttgagcggg
agcggtttggtgctgatttatgaagccctgtctaagcgcaaaggcttagaaaaagcagca
aagttaagcaaggctgaattaaccccacaaatcattagcgaacgcgctttgaatggggat
taccctatatgccgattgactttggacactttttgctccatgctaggcacgcttgctgct
gatgtggctctcactttgggggctagagggggcgtgtatttgtgtggggggattatccca
cgattcattgattattttaaaacttcgccctttagagcgcgttttgaaacgaaagggcgc
atgggagcgtttctcgcttctatccctgtgcatgtcgtgctgaaaaaaaccccgggactt
aatggggcgggcattgcgttagagaattatttactgcatgataagatatag

DBGET integrated database retrieval system