KEGG   Helicobacter pylori Aklavik86: HPAKL86_05765Help
Entry
HPAKL86_05765     CDS       T02353                                 

Gene name
porD
Definition
(GenBank) pyruvate flavodoxin oxidoreductase subunit delta
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
hpyk  Helicobacter pylori Aklavik86
Pathway
hpyk00010  Glycolysis / Gluconeogenesis
hpyk00020  Citrate cycle (TCA cycle)
hpyk00620  Pyruvate metabolism
hpyk00640  Propanoate metabolism
hpyk00650  Butanoate metabolism
hpyk00680  Methane metabolism
hpyk01100  Metabolic pathways
hpyk01120  Microbial metabolism in diverse environments
hpyk01130  Biosynthesis of antibiotics
hpyk01200  Carbon metabolism
Module
hpyk_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hpyk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPAKL86_05765 (porD)
   00020 Citrate cycle (TCA cycle)
    HPAKL86_05765 (porD)
   00620 Pyruvate metabolism
    HPAKL86_05765 (porD)
   00640 Propanoate metabolism
    HPAKL86_05765 (porD)
   00650 Butanoate metabolism
    HPAKL86_05765 (porD)
  Energy metabolism
   00680 Methane metabolism
    HPAKL86_05765 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPAKL86_05765 (porD)
Enzymes [BR:hpyk01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPAKL86_05765 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_21 Fer4 Fer4_6 Fer4_2 Fer4_10 Fer4_17 Fer4_9 Fer4_7 Fer4_16 Fer4_15 Fer4_8 Fer4_4 Fer4_13 Fer4_18
Motif
Other DBs
NCBI-ProteinID: AFX90143
UniProt: K7YAT8
Position
1214166..1214558
Genome map
AA seq 130 aa AA seqDB search
MKDWNEFEMGAVLFPFEKNAQSEMEKHNDERHYTEQSYFTTSVAHWRVAKPVHNNNICIN
CFNCWVYCPDAAILSREGKLKGVDYSHCKGCGVCVSVCPTNPKSLWMFEEQIEPASALAQ
WPQKEEKKKS
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgaaagattggaatgaatttgaaatgggagcggtgctcttcccttttgaaaaaaacgca
caaagcgaaatggaaaaacacaatgatgagcgccattacaccgagcaaagctacttcacc
acttcagtggctcattggcgcgtggctaagcctgtgcataacaataacatttgcatcaac
tgctttaattgttgggtttattgcccagatgccgctatcctttcaagagagggcaagtta
aaaggcgtggattattctcattgtaaaggctgtggcgtgtgcgtgagtgtctgccccacc
aaccccaaatcgctttggatgtttgaagaacaaattgagcctgctagcgctcttgctcaa
tggccgcaaaaagaagaaaagaaaaaatcataa

DBGET integrated database retrieval system