KEGG   Helicobacter pylori Aklavik86: HPAKL86_06365Help
Entry
HPAKL86_06365     CDS       T02353                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hpyk  Helicobacter pylori Aklavik86
Brite
Enzymes [BR:hpyk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     HPAKL86_06365
Secretion system [BR:hpyk02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   HPAKL86_06365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1334906..1335694)
Genome map
AA seq 262 aa AA seqDB search
MILRASVLSALLLVGLGAAPKNATNKPMQDNLIKVIEKQTNKKVRILEIKPLKSNQDLKI
VVVEDPDTKYQIPLVVSKDGNLIIGLSNIFFSNKSDDVQLVAETNQKVQALNATQQNSAK
LNAIFDEVPADYVIELPSTNAANRDKILYIVSDPMCPHCQRELTKLRDHLKENTVRMVIV
GWLGVNSAKKAALIQGEMAQARARGASVEDKISIIEKIYSTQYDINAQKEPEDLRTKVEN
VTKKIFEPGVIKGVPFLYHYRA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgatattaagagcgagtgtgttgagcgcgttacttcttgtaggcttaggggcagcccct
aaaaacgccactaataaaccaatgcaagacaatttgattaaagtgattgaaaaacaaacc
aataaaaaggtgcgtattttagaaatcaaacctttgaaatccaatcaagatttaaaaatc
gtggtggtagaagacccagacactaagtatcaaatcccgcttgtggtgagtaaggatggt
aatttaatcatagggcttagcaatatcttttttagcaataaaagcgatgatgtgcaatta
gtcgcagaaaccaatcaaaaagtccaagcccttaacgctacccaacaaaacagcgcgaag
ttgaacgctatttttgatgaagtgccagctgattatgtgatagagttgccttccactaac
gctgcaaacagggataagatcctttatattgtttctgatcccatgtgcccgcattgccaa
agggagctcactaaactcagagaccatttgaaagaaaacaccgtgagaatggttattgta
gggtggcttggagtcaattcggctaaaaaagcggctttgatccaaggagaaatggcgcaa
gctagagctaggggagcgagcgtggaagataaaatctctatcattgaaaagatttattcc
acccaatacgatattaacgcccagaaagagcctgaagatttacgcactaaagtggaaaat
gtcactaaaaagatttttgaacctggcgtgattaaaggcgtgcctttcttgtatcattat
agggcatga

DBGET integrated database retrieval system