KEGG   Helicobacter pylori OK310: HPOK310_0123Help
Entry
HPOK310_0123      CDS       T02542                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hpyl  Helicobacter pylori OK310
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hpyl00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HPOK310_0123
Enzymes [BR:hpyl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     HPOK310_0123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
126623..127186
Genome map
AA seq 187 aa AA seqDB search
MFRKGFFGLYQGSISARIGTNQFVINKRNAVFDQLNENTLLVLHDKIDYRWKEASLDSPI
HASVYREFLDAKFIAYARPPYSLAYSLRHNRLLPRDYLGYRSLGEEISIFNPKDYDSWQE
RADTEILRQLQESKKYFVFIKGCGIFAYHRELSKLMEIFDLIENSCKVLRLGDLMDYCYN
DDPRLSV
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgtttagaaagggtttttttgggctttatcaaggctctatttcagcgcgcattggtacg
aatcaatttgtgatcaataaaagaaacgctgtttttgatcaattgaatgaaaacacctta
ctggttttgcatgataagatagattatcgctggaaagaagcgagcctagattcacccatt
catgcgagcgtgtatagggagtttttggacgctaaattcatcgcttacgcgcgccctcct
tatagcttggcgtattccttgcgccacaaccgattgctccctagagattatttagggtat
cgttctttgggcgaagaaatttccatttttaaccccaaagactatgacagctggcaagaa
agagcggatacagaaattttacgccaactgcaagagagcaaaaaatattttgttttcatt
aaggggtgcgggatttttgcctaccacagagagctttctaaactcatggagatttttgat
ttgattgaaaactcatgcaaggttttacgactaggcgatttaatggattattgctataat
gatgatccacgattgagcgtgtaa

DBGET integrated database retrieval system