KEGG   Helicobacter pylori OK310: HPOK310_0680Help
Entry
HPOK310_0680      CDS       T02542                                 

Gene name
thl
Definition
(GenBank) acetyl coenzyme A acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hpyl  Helicobacter pylori OK310
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:hpyl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    HPOK310_0680 (thl)
   00630 Glyoxylate and dicarboxylate metabolism
    HPOK310_0680 (thl)
   00640 Propanoate metabolism
    HPOK310_0680 (thl)
   00650 Butanoate metabolism
    HPOK310_0680 (thl)
  Lipid metabolism
   00071 Fatty acid degradation
    HPOK310_0680 (thl)
   00072 Synthesis and degradation of ketone bodies
    HPOK310_0680 (thl)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HPOK310_0680 (thl)
   00310 Lysine degradation
    HPOK310_0680 (thl)
   00380 Tryptophan metabolism
    HPOK310_0680 (thl)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPOK310_0680 (thl)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HPOK310_0680 (thl)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    HPOK310_0680 (thl)
Enzymes [BR:hpyl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HPOK310_0680 (thl)
Exosome [BR:hpyl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HPOK310_0680 (thl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
696687..697862
Genome map
AA seq 391 aa AA seqDB search
MNEVVVVAAKRSAVGSFLGSLKSVGAREMGAVVLKDALKASGLEPSDVDSVILGNVLSAG
LGQNIARQIQLDAGIPNDRNAFSVNMVCGSSMKAIQLAHDAIMLGRDEVVVCGGVENMSA
APYLSFDMRDGKRMGNANMIDSMIHDGLWDAFNDYHMGITADNVAQAYHISREEQDAFAL
QSQLKARSAINAGKFQEEITPIEIANKKGVVVFKEDEYPRETTLESLAKLKPAFKKDGSV
TAGNSSGINDGASVIILCSAQKAQKLGLKTMATIKGFGLGGCSPDIMGICPSIAIKNNLK
NVKMNLNDINLFELNEAFAAQSIAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKRSAHGVGCASLCVGGGQGLSVIVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttgtagtggcggcaaaacgaagcgctgtggggagttttttaggctct
ctaaagagcgtgggcgctagagaaatgggtgctgtcgtgcttaaagacgctctgaaagcg
agcggtcttgagccaagcgatgtggattctgtcattttaggcaatgttttatccgctggt
ttgggtcaaaatattgccaggcagatccaactggacgcgggcataccgaatgacaggaac
gcttttagcgtcaatatggtttgtggatcgtctatgaaagccattcaattagcacatgat
gccatcatgcttgggcgcgatgaggtggtggtgtgcggtggcgtggaaaatatgagtgca
gcgccttatttgtcgtttgacatgcgagatgggaaaagaatggggaatgccaacatgata
gactccatgatccatgacggattgtgggatgcgttcaatgattaccacatggggatcacc
gctgataatgtcgctcaagcataccacatcagccgagaagagcaagatgctttcgcgctc
caatcgcaactcaaagcaagatctgccattaatgcagggaaatttcaagaagaaatcacg
cctattgaaatagcgaataaaaaaggcgtggttgtttttaaagaagacgaataccctaga
gaaacgacactagaatcccttgcaaagctcaaacccgctttcaaaaaagacggatcggta
acggcaggaaattcatcagggatcaatgatggcgcgagtgttatcattttatgcagcgct
caaaaagcgcaaaaattagggttaaaaacaatggcaactatcaaggggtttggtttgggt
ggttgcagtccggatataatggggatatgccctagtattgctattaaaaacaatcttaaa
aatgtcaaaatgaatctcaatgacatcaatctttttgaactcaatgaagctttcgccgcg
caaagcatagccgtgttaaaagagcttgagttaaaccccaatatcgtgaatgtgaatgga
ggtgcgatagccattggccaccctattggcgcaagcggtgctaggattttggtaacttta
ttgcatgaaatgaaaagaagcgctcatggcgtgggctgcgcgtcattgtgtgtgggcggc
ggacaagggctatcagtaatagtggaacaaaaataa

DBGET integrated database retrieval system