KEGG   Helicobacter pylori OK310: HPOK310_1117Help
Entry
HPOK310_1117      CDS       T02542                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hpyl  Helicobacter pylori OK310
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:hpyl00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1216510..1217172
Genome map
AA seq 220 aa AA seqDB search
MHSQRIAPYKTLILNEFCYYPLELDPTPFSALIFTSKNAVFSLLETLKNSPKLKILQNIP
AYALSEPTAKTLQDHHFKVAFIGKKAHGKEFVQEILPLLEKKSVLYLRAKEIVSSLDAIL
LEHGIDFKQAVVYENKLKHLTLSEQNALKPKEKSILIFTAISHAKAFLHYFEFLENYTAI
SIGNTTALYLQEQGIQSYSAKKPSLEACLELALSLRVKEC
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
gtgcattctcaaagaatcgccccttataagactctcattttaaatgaattttgctactat
cccttagaattagatccaaccccttttagtgcccttattttcacttctaaaaatgcggtg
ttttccttgctagaaactctaaaaaacagccccaaactcaaaattttacaaaacattcct
gcttacgctttgagcgaacccaccgcaaaaactttacaagatcaccattttaaagtcgcc
tttatagggaaaaaagcccatggcaaagagtttgttcaagaaatccttcctttattggaa
aaaaaaagcgttttgtatctcagggcaaaagagattgtctcttctttagacgccattctt
ttagagcatggcattgatttcaagcaagccgttgtttatgagaataagctcaaacatttg
actttaagcgaacaaaacgccctaaaacccaaagaaaagagcattcttatttttaccgcc
ataagccatgcaaaagcctttttacactattttgaatttttagaaaattacaccgctata
agcattggcaacacgaccgctctttatttgcaagagcaaggcattcaaagctatagcgct
aaaaagccctctttagaagcgtgtttagaactggctttgagtttgagggttaaggaatgt
taa

DBGET integrated database retrieval system