KEGG   Helicobacter pylori UM299: K749_03240Help
Entry
K749_03240        CDS       T02661                                 

Definition
catalase
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
hpym  Helicobacter pylori UM299
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hpym00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    K749_03240
  Amino acid metabolism
   00380 Tryptophan metabolism
    K749_03240
Enzymes [BR:hpym01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     K749_03240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
96074..97591
Genome map
AA seq 505 aa AA seqDB search
MVNKDVKQTTAFGAPVWDDNNVITAGPRGPVLLQSTWFLEKLAAFDRERIPERVVHAKGS
GAYGTFTVTKDITKYTKAKIFSKVGKKTECFFRFSTVAGERGSADAVRDPRGFAMKYYTE
EGNWDLVGNNTPVFFIRDAIKFPDFIHTQKRDPQTNLPNPDMVWDFWSSVPESLYQVTWV
MSDRGIPKSFRHMDGFGSHTFSLINAKGERFWVKFHFHTMQGVKHLTNEEAAEIRKHDPD
SNQRDLFDAIARGDFPKWKLSIQVMPEEDAKKYRFHPFDVTKIWYLKDYPLMEVGIVELN
KNPENYFAEVEQAAFTPANVVPGIGYSPDRMLQGRLFSYGDTHRYRLGVNYPQIPVNKPR
CPFHSSSRDGYMQNGYYGSLQNYTPSSLPGYKEDKSARDPKFNLAHIEKEFEVWNWDYRA
DDSDYYTQPGDYYRSLPADEKERLYDTIGGSLAHVTHKEIVDKQLEHFKKADPKYAEGVK
KALEKHQKMMKDMHGKDMHHMKKKK
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggttaataaagatgtgaaacaaaccactgcttttggcgctcccgtttgggatgataac
aatgtgattacggctggccctagaggtcctgttttattacaaagcacttggtttttggaa
aagttagcggcgtttgatcgagaaaggattcctgaaagggtggtgcatgctaaaggaagc
ggagcttatggcactttcaccgtgactaaagacatcactaaatacactaaagcgaaaatt
ttctctaaagtgggcaaaaaaacagaatgctttttcagattctctactgtggctggtgaa
agaggcagtgcggatgcggtgagagaccctagaggttttgcgatgaagtattacactgaa
gaaggtaactgggatttagtagggaacaacacgcctgttttctttatccgtgatgcgatc
aaattccctgatttcatccacactcaaaaacgagaccctcaaaccaatttgcctaacccc
gacatggtgtgggatttttggagtagtgttcctgaaagcttataccaagtaacatgggtt
atgagcgataggggtattcctaaatctttccgccacatggatggttttggcagccacact
ttcagccttatcaatgcgaaaggcgaacgcttctgggtgaaattccactttcacaccatg
caaggcgttaagcacttgactaatgaagaagccgcagaaatcagaaagcatgatcctgat
tccaatcaaagggatttattcgatgcgatcgctagaggggatttcccaaaatggaaattg
agcattcaagtgatgccagaagaagatgctaaaaagtatcgattccatccgtttgatgtg
actaaaatttggtatctcaaagattatccgttgatggaagtgggcattgtagagttgaat
aaaaatcctgaaaactatttcgcagaagtggagcaagcggcattcactccggctaatgtc
gttcctgggattggctatagccctgataggatgttacaagggcgcttgttctcttatgga
gacacacaccgctaccgcttaggcgttaattatcctcaaataccggttaataaaccaaga
tgcccgttccactcttctagcagagatggttacatgcaaaacggatactacggctcttta
caaaactatacgcctagctcattgccaggttataaagaagataagagtgcgagggatcct
aagttcaacttagctcatattgagaaagagtttgaagtgtggaattgggattacagagct
gatgatagcgattactacacccaaccaggtgattactaccgctcgttgccagctgatgaa
aaagaaaggttgtatgacactattggaggatctttagctcatgttacccataaagaaatt
gtggataaacaattggagcatttcaagaaagctgaccccaaatacgctgagggagttaaa
aaagctcttgaaaaacaccaaaaaatgatgaaagacatgcatggaaaagacatgcaccac
atgaaaaagaaaaagtaa

DBGET integrated database retrieval system