KEGG   Helicobacter pylori UM299: K749_03285Help
Entry
K749_03285        CDS       T02661                                 

Definition
catalase
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
hpym  Helicobacter pylori UM299
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:hpym00630]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:hpym00380]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(83712..84656)
Genome map
AA seq 314 aa AA seqDB search
MKKIGLSLCLVFSLGFLKAHEVSAEEIADIFYKLNAKEPKMKINHTKGFCAKGVFLPNVQ
AKKDLDVPLLNEKEIPASVRYSLGGVAMDDKSKVRGMALKLENQNASWTMVMLNTEINFA
KNPNEFAQFFEMRIPKNGKVDEARIKKLYEEIPSYRNFAAYTKTIGISSSVANTPYYSVH
AFKFKDKKEKLLPARWKFVPKDGIKYLNPQELKQKDSNYLLSSFQQHLKDKPIEYQMYLV
FANKNDATNDTTALWKGKHKELLVGTLKVEKYEGMGCNKDVYFPADLPKGVEAPTDPLFQ
IRNEVYGITFNRRQ
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattggtttgagcttgtgtttggtttttagcttgggttttttaaaagcccat
gaagtgagcgctgaagagattgcggatattttctacaaactcaacgccaaagagcctaaa
atgaaaatcaaccacactaaggggttttgcgctaaaggcgtgttcctccctaatgtgcaa
gcaaaaaaggatttagatgtgccattactcaatgaaaaagaaatccctgcgtctgtaagg
tattctttaggaggcgtggcgatggacgataaaagcaaagtcaggggaatggcgttaaaa
ttagaaaaccaaaacgctagctggacaatggtgatgctcaatacagaaatcaattttgcc
aaaaaccctaacgaattcgctcaattttttgagatgagaatccctaaaaatggcaaggtg
gatgaagcaagaatcaaaaagctttatgaagaaatcccctcttataggaattttgccgct
tacacaaaaacgatagggattagctcaagcgtggctaacacgccttattatagcgtgcat
gcgttcaagtttaaagataagaaagaaaaattattgcctgcgagatggaaatttgtgcct
aaagacggcattaagtatcttaacccccaagaattaaagcaaaaagattcaaattatctg
ctttcttcattccaacaacaccttaaagataaacccatagaataccaaatgtatctggtg
tttgcgaataaaaatgatgccaccaacgacacgaccgcgctttggaaaggcaaacacaag
gaattactggtagggacattgaaagttgaaaaatacgaaggaatgggttgcaataaagat
gtgtatttcccagccgatctccctaaaggcgtagaagcccctactgatcccttattccaa
atcaggaatgaagtttatgggatcacttttaatagaaggcaataa

DBGET integrated database retrieval system