KEGG   Helicobacter pylori UM299: K749_03285Help
Entry
K749_03285        CDS       T02661                                 

Definition
catalase
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
hpym  Helicobacter pylori UM299
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hpym00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    K749_03285
  Amino acid metabolism
   00380 Tryptophan metabolism
    K749_03285
Enzymes [BR:hpym01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     K749_03285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(83712..84656)
Genome map
AA seq 314 aa AA seqDB search
MKKIGLSLCLVFSLGFLKAHEVSAEEIADIFYKLNAKEPKMKINHTKGFCAKGVFLPNVQ
AKKDLDVPLLNEKEIPASVRYSLGGVAMDDKSKVRGMALKLENQNASWTMVMLNTEINFA
KNPNEFAQFFEMRIPKNGKVDEARIKKLYEEIPSYRNFAAYTKTIGISSSVANTPYYSVH
AFKFKDKKEKLLPARWKFVPKDGIKYLNPQELKQKDSNYLLSSFQQHLKDKPIEYQMYLV
FANKNDATNDTTALWKGKHKELLVGTLKVEKYEGMGCNKDVYFPADLPKGVEAPTDPLFQ
IRNEVYGITFNRRQ
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattggtttgagcttgtgtttggtttttagcttgggttttttaaaagcccat
gaagtgagcgctgaagagattgcggatattttctacaaactcaacgccaaagagcctaaa
atgaaaatcaaccacactaaggggttttgcgctaaaggcgtgttcctccctaatgtgcaa
gcaaaaaaggatttagatgtgccattactcaatgaaaaagaaatccctgcgtctgtaagg
tattctttaggaggcgtggcgatggacgataaaagcaaagtcaggggaatggcgttaaaa
ttagaaaaccaaaacgctagctggacaatggtgatgctcaatacagaaatcaattttgcc
aaaaaccctaacgaattcgctcaattttttgagatgagaatccctaaaaatggcaaggtg
gatgaagcaagaatcaaaaagctttatgaagaaatcccctcttataggaattttgccgct
tacacaaaaacgatagggattagctcaagcgtggctaacacgccttattatagcgtgcat
gcgttcaagtttaaagataagaaagaaaaattattgcctgcgagatggaaatttgtgcct
aaagacggcattaagtatcttaacccccaagaattaaagcaaaaagattcaaattatctg
ctttcttcattccaacaacaccttaaagataaacccatagaataccaaatgtatctggtg
tttgcgaataaaaatgatgccaccaacgacacgaccgcgctttggaaaggcaaacacaag
gaattactggtagggacattgaaagttgaaaaatacgaaggaatgggttgcaataaagat
gtgtatttcccagccgatctccctaaaggcgtagaagcccctactgatcccttattccaa
atcaggaatgaagtttatgggatcacttttaatagaaggcaataa

DBGET integrated database retrieval system