KEGG   Helicobacter pylori OK113: HPOK113_0124Help
Entry
HPOK113_0124      CDS       T02510                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hpyo  Helicobacter pylori OK113
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hpyo00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HPOK113_0124
Enzymes [BR:hpyo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     HPOK113_0124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
128952..129581
Genome map
AA seq 209 aa AA seqDB search
MNTHTRGIDSNLIHSLQSISLSMFRKGFFGLYQGSISARIGTNQFVINKRNAVFDQLNEN
TLLVLHDKIDYRWKEASLDSPIHASVYREFLDAKFIAYARPPYSLAYSLRHNRLLPRDYL
GYRSLGEEISIFNPKDYDSWQERADTEILRQLQESKKYFVFIKGCGIFAYHRELPKLMEV
FDLIENSCKVLRLGDLMDYCYNDDPRLSV
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaacacacacacaagaggcattgacagcaatctgattcattcgctccaaagcatttca
ttatccatgtttagaaagggtttttttgggctttatcaaggctctatttcagcgcgcatt
ggcactaaccaatttgtgatcaataaaagaaacgctgtttttgatcaattgaatgaaaac
accttactggttttgcatgacaagatagattaccgctggaaagaagcaagtctggattcg
cccattcatgcgagcgtgtatagggagtttttggacgctaaattcatcgcttatgcgcgc
cctccttatagtttggcgtattccttgcgccacaaccgattgctccctagggattattta
gggtatcgttctttgggcgaagaaatttccatttttaaccccaaagactatgacagctgg
caagaaagagcggatacagaaattttacgccaactgcaagagagcaaaaaatattttgtt
ttcattaaggggtgcgggatttttgcctaccacagagagcttcctaaactcatggaagtt
tttgatttgattgaaaactcatgcaaggttttacgactgggcgatttaatggattattgc
tataatgatgatccacgattgagcgtgtaa

DBGET integrated database retrieval system