KEGG   Helicobacter pylori OK113: HPOK113_0124Help
Entry
HPOK113_0124      CDS       T02510                                 

Definition
(GenBank) hypothetical protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hpyo  Helicobacter pylori OK113
Pathway
hpyo00051  Fructose and mannose metabolism
hpyo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hpyo00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HPOK113_0124
Enzymes [BR:hpyo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     HPOK113_0124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II SelP_N
Motif
Other DBs
NCBI-ProteinID: BAM96032
UniProt: M4ZHU0
Position
128952..129581
Genome map
AA seq 209 aa AA seqDB search
MNTHTRGIDSNLIHSLQSISLSMFRKGFFGLYQGSISARIGTNQFVINKRNAVFDQLNEN
TLLVLHDKIDYRWKEASLDSPIHASVYREFLDAKFIAYARPPYSLAYSLRHNRLLPRDYL
GYRSLGEEISIFNPKDYDSWQERADTEILRQLQESKKYFVFIKGCGIFAYHRELPKLMEV
FDLIENSCKVLRLGDLMDYCYNDDPRLSV
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaacacacacacaagaggcattgacagcaatctgattcattcgctccaaagcatttca
ttatccatgtttagaaagggtttttttgggctttatcaaggctctatttcagcgcgcatt
ggcactaaccaatttgtgatcaataaaagaaacgctgtttttgatcaattgaatgaaaac
accttactggttttgcatgacaagatagattaccgctggaaagaagcaagtctggattcg
cccattcatgcgagcgtgtatagggagtttttggacgctaaattcatcgcttatgcgcgc
cctccttatagtttggcgtattccttgcgccacaaccgattgctccctagggattattta
gggtatcgttctttgggcgaagaaatttccatttttaaccccaaagactatgacagctgg
caagaaagagcggatacagaaattttacgccaactgcaagagagcaaaaaatattttgtt
ttcattaaggggtgcgggatttttgcctaccacagagagcttcctaaactcatggaagtt
tttgatttgattgaaaactcatgcaaggttttacgactgggcgatttaatggattattgc
tataatgatgatccacgattgagcgtgtaa

DBGET integrated database retrieval system