KEGG   Helicobacter pylori OK113: HPOK113_1455Help
Entry
HPOK113_1455      CDS       T02510                                 

Gene name
rocF
Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
hpyo  Helicobacter pylori OK113
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hpyo01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:hpyo00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1549235..1550203)
Genome map
AA seq 322 aa AA seqDB search
MILVGLEAELGASKRGTDKGVRRLREVLSATHGDVIKGMQTIIQERCVLYKEFRYAKNFE
DYYLFCKENLIPCMKEVFEKKEFPLILSSEHANMFGIFQAFRSVHKDKKIGILYLDAHAD
IHTAYDSDSKHIHGMPLGMVLNRVRSGFNRMSESEEKAWQKLCSLGLEKGALEIDPKCLV
YFGVRSTEQSERDVIKELQIPLFSVEAIRENMREVVQKTKELLKAVDIIYLSLDLDIMDG
KLFTSTGVRENNGLSFDELKQLLGLLLENFKDRLKAVEVTEYNPTVSAKHTNEEEKQVLE
ILDLIINSCKIKDKKPSFIMSR
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgattttagtaggattggaagcggaattaggagcgtcaaaaagaggcaccgataaaggg
gttaggcgtttgagagaagttttgagcgcaacgcatggcgatgtgattaaaggcatgcaa
acaatcattcaagagcggtgcgtgctttataaagagtttagatacgctaagaattttgaa
gattactaccttttttgtaaagaaaatttgatcccttgcatgaaagaagtgtttgagaaa
aaagaatttcctttgattttaagctcagagcatgcgaacatgtttgggattttccaagcc
tttaggagcgttcataaggacaaaaaaatagggattttgtatttagacgcgcatgcagat
attcatacggcttatgacagcgattcaaagcatatccacggcatgcctttaggcatggtt
ttaaatcgtgtccgtagcgggttcaatcgcatgagcgagagcgaagaaaaggcatggcaa
aagctctgctctttggggttagaaaagggagcgttagaaattgatcctaaatgtttggtg
tattttggggtaagaagcaccgaacagagcgaaagggatgtgattaaagaattgcaaatc
cctttatttagcgtggaagcgataagagaaaacatgcgagaagtggttcaaaaaaccaaa
gaattgttaaaagcggtggatattatttacctcagtttggatttagacattatggatggc
aagcttttcacttctaccggcgtgcgtgaaaacaacgggctgagttttgatgagctcaag
caattactgggcttgcttttagaaaactttaaagacagattaaaagcggttgaggtaacc
gaatacaaccccacggtgagtgcaaaacacaccaacgaagaagaaaagcaggttttagag
atcttagatctcatcatcaatagctgtaaaattaaagacaagaagccatcttttataatg
agtcgctga

DBGET integrated database retrieval system