KEGG   Helicobacter pylori OK113: HPOK113_1455Help
Entry
HPOK113_1455      CDS       T02510                                 

Gene name
rocF
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
hpyo  Helicobacter pylori OK113
Pathway
hpyo00220  Arginine biosynthesis
hpyo00330  Arginine and proline metabolism
hpyo01100  Metabolic pathways
hpyo01110  Biosynthesis of secondary metabolites
hpyo01130  Biosynthesis of antibiotics
hpyo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpyo00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    HPOK113_1455 (rocF)
   00330 Arginine and proline metabolism
    HPOK113_1455 (rocF)
Enzymes [BR:hpyo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     HPOK113_1455 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: BAM97363
UniProt: M4ZLT4
Structure
PDB: 

Jmol
Position
complement(1549235..1550203)
Genome map
AA seq 322 aa AA seqDB search
MILVGLEAELGASKRGTDKGVRRLREVLSATHGDVIKGMQTIIQERCVLYKEFRYAKNFE
DYYLFCKENLIPCMKEVFEKKEFPLILSSEHANMFGIFQAFRSVHKDKKIGILYLDAHAD
IHTAYDSDSKHIHGMPLGMVLNRVRSGFNRMSESEEKAWQKLCSLGLEKGALEIDPKCLV
YFGVRSTEQSERDVIKELQIPLFSVEAIRENMREVVQKTKELLKAVDIIYLSLDLDIMDG
KLFTSTGVRENNGLSFDELKQLLGLLLENFKDRLKAVEVTEYNPTVSAKHTNEEEKQVLE
ILDLIINSCKIKDKKPSFIMSR
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgattttagtaggattggaagcggaattaggagcgtcaaaaagaggcaccgataaaggg
gttaggcgtttgagagaagttttgagcgcaacgcatggcgatgtgattaaaggcatgcaa
acaatcattcaagagcggtgcgtgctttataaagagtttagatacgctaagaattttgaa
gattactaccttttttgtaaagaaaatttgatcccttgcatgaaagaagtgtttgagaaa
aaagaatttcctttgattttaagctcagagcatgcgaacatgtttgggattttccaagcc
tttaggagcgttcataaggacaaaaaaatagggattttgtatttagacgcgcatgcagat
attcatacggcttatgacagcgattcaaagcatatccacggcatgcctttaggcatggtt
ttaaatcgtgtccgtagcgggttcaatcgcatgagcgagagcgaagaaaaggcatggcaa
aagctctgctctttggggttagaaaagggagcgttagaaattgatcctaaatgtttggtg
tattttggggtaagaagcaccgaacagagcgaaagggatgtgattaaagaattgcaaatc
cctttatttagcgtggaagcgataagagaaaacatgcgagaagtggttcaaaaaaccaaa
gaattgttaaaagcggtggatattatttacctcagtttggatttagacattatggatggc
aagcttttcacttctaccggcgtgcgtgaaaacaacgggctgagttttgatgagctcaag
caattactgggcttgcttttagaaaactttaaagacagattaaaagcggttgaggtaacc
gaatacaaccccacggtgagtgcaaaacacaccaacgaagaagaaaagcaggttttagag
atcttagatctcatcatcaatagctgtaaaattaaagacaagaagccatcttttataatg
agtcgctga

DBGET integrated database retrieval system