KEGG   Helicobacter pylori SouthAfrica20: HPSA20_0130Help
Entry
HPSA20_0130       CDS       T02807                                 

Definition
class II Aldolase and Adducin N-terminal domain protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hpys  Helicobacter pylori SouthAfrica20
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hpys00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HPSA20_0130
Enzymes [BR:hpys01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     HPSA20_0130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
119566..120204
Genome map
AA seq 212 aa AA seqDB search
MPSMNTHTRGIDSGLIRSLQSISLSMFRKGFFGLYQGSISARIGTNQFVINKRNAVFDQL
NENTLLVLHDKIDYRWKEASLDSPIHASVYKEFLDAKFIAYARPPYSLAYSLRHNRLLPR
DYLGYRSLGEEVTIFNPKDYDSWQERADTEILRQLQESKKYFVFIKGCGIFAYHRELSKL
MEVFDLIENSCKVLRLGDLMDFCYNDDPRLSV
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgccaagcatgaacacacacacaagaggcattgacagcgggctgattcgttcgctccaa
agcatttcattatccatgtttagaaagggtttttttgggctttatcaaggctccatttct
gcacgcattggcactaaccagtttgtgatcaataaaagaaacgctgtttttgatcaattg
aatgaaaacaccttattagttttgcatgacaaaatagattaccgctggaaagaagcaagc
cttgattcgcctatccatgcgagcgtgtataaggagtttttggacgctaaatttatcgct
tatgcacgccctccttatagtttggcgtattctttgcgccataaccggttgctccctaga
gattatttagggtatcgttctttgggcgaagaagtaacgatttttaaccccaaagattat
gacagctggcaagaaagagcggatacagaaatcttacgccagttgcaagagagcaaaaaa
tattttgttttcattaaagggtgcgggatttttgcctaccacagagagctttctaaactc
atggaagtttttgatttgattgaaaattcatgcaaggttttacgattgggcgatttaatg
gatttttgttataatgatgatccacgattgagcgtgtaa

DBGET integrated database retrieval system