KEGG   Helicobacter pylori SouthAfrica20: HPSA20_0257Help
Entry
HPSA20_0257       CDS       T02807                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hpys  Helicobacter pylori SouthAfrica20
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
239510..240301
Genome map
AA seq 263 aa AA seqDB search
MILRASVLSALLLVSLGAAPKNPASNKQMQDNLVKVIEKQTNKKVRILEVKPLKSSQDLK
MVVVEDPDTKYNIPLVVSKDGNLVIGLSGIFFSNNSDDVKLLTETNQKILALNTTQQNSA
KLNAIFDEVPADYVIELPSTNAENKDKILYIVSDPMCPHCQKELTKLRDHLKENTVRMVV
VGWLGVNSAKKAALVQEEMAKARARGASVENKISILEKIYSTQYDINAQKEPEDLRTKVE
NITKKIFESGVIKGVPFLYHYKA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgatattaagagcgagcgtgttgagcgcgttacttcttgtaagtttaggggcagcccct
aaaaacccagcatctaataaacaaatgcaagacaatttagttaaggtgattgaaaaacaa
accaataaaaaggtgcgtattttagaagtcaaacctttgaaatccagccaggatttgaaa
atggtcgtagtagaagatccggacactaaatacaatatcccacttgtagtgagcaaagat
ggcaatttagtcatagggcttagcggtatcttttttagcaataatagcgatgatgtgaag
ttgctcacagagaccaatcaaaaaatcctagcccttaacaccactcagcaaaatagcgcg
aaattgaacgctatttttgatgaagtgccggctgattatgtgatagagttgccttccact
aacgctgagaataaggacaagatcctttatattgtctccgatcccatgtgcccgcattgc
caaaaagagctcactaaactcagagatcacttgaaagaaaacaccgtgagaatggttgta
gtggggtggcttggggtcaattcggctaaaaaagcggctttggttcaagaagaaatggcg
aaagctagggctaggggagcgagcgtggaaaataaaatctctattcttgaaaagatttat
tccacccaatacgatattaacgcccaaaaagagcctgaagatttacgcactaaagtggaa
aatatcacgaaaaagatttttgaatcgggcgtgattaaaggcgtgcctttcttataccat
tataaggcatag

DBGET integrated database retrieval system