KEGG   Helicobacter pylori UM066: K751_05080Help
Entry
K751_05080        CDS       T02660                                 

Definition
catalase
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
hpyu  Helicobacter pylori UM066
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hpyu00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    K751_05080
  Amino acid metabolism
   00380 Tryptophan metabolism
    K751_05080
Enzymes [BR:hpyu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     K751_05080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
620532..622049
Genome map
AA seq 505 aa AA seqDB search
MVNKDVKQTTAFGAPVWDDNNVITAGPRGPVLLQSTWFLEKLAAFDRERIPERVVHAKGS
GAYGTFTVTKDITKYTKAKIFSKVGKKTECFFRFSTVAGERGSADAVRDPRGFAMKYYTE
EGNWDLVGNNTPVFFIRDAIKFPDFIHTQKRDPQTNLPNPDMVWDFWSNVPESLYQVTWV
MSDRGIPKSFRHMDGFGSHTFSLINAKGERFWVKFHFLTMQGVKHLTNEEAAEIRKHDPD
SNQRDLFDAIARGDFPKWKLSIQVMPEEDAKKYRFHPFDVTKIWYLKDYPLMEVGIVELN
KNPENYFAEVEQAAFTPANVVPGIGYSPDRMLQGRLFSYGDTHRYRLGVNYPQIPVNKPR
CPFHSSSRDGYMQNGYYGSLQNYTPSSLPGYKEDKSARDPKFNLAHIEKEFEVWNWDYRA
DDSDYYTQPGDYYRSLPADEKERLHDTIGESLAHVTHKEIVDKQLEHFKKADPKYAEGVK
KALEKHQKMMKDMHGKDMHHMKKKK
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggttaataaagatgtgaaacaaaccactgcttttggcgctcccgtttgggatgacaac
aatgtgattacggctggccctagaggtcctgttttattacaaagcacttggtttttggaa
aagttagcggcatttgatcgagaaagaatccctgaaagggtggtgcatgctaaaggaagc
ggagcttatggcactttcaccgtgactaaagacatcactaaatacactaaagcgaaaatt
ttctctaaagtgggcaaaaaaacagaatgctttttcagattttctactgtggcaggggaa
agaggcagtgcggatgcagtgagagaccctagaggttttgcgatgaagtattacactgaa
gaaggtaactgggatttggtagggaacaacacgcctgttttctttatccgtgatgcgatc
aaattccctgatttcatccacactcaaaaacgagatcctcaaaccaatttgcctaacccc
gacatggtatgggatttttggagtaatgttcctgaaagcttgtatcaagtaacatgggtt
atgagcgataggggtattcctaaatctttccgccacatggatggttttggcagccacact
ttcagcctcatcaacgcgaaaggcgaacgcttttgggtgaaattccactttttaaccatg
caaggcgtgaagcacttgactaatgaagaagccgcagaaatcagaaagcatgatcctgat
tccaatcaaagggatttattcgatgcgatcgctagaggggatttcccaaaatggaaattg
agcattcaagtgatgccagaagaagatgctaaaaagtatcgattccatccgtttgatgtg
actaaaatttggtatctcaaagattatccattgatggaagtgggtattgtagagttgaat
aaaaatcctgaaaactatttcgcagaagtggagcaagcggcattcactccggctaatgtc
gttcctggaattggctatagccctgataggatgttgcaagggcgcttgttctcttatggg
gacacacaccgctaccgcttaggggttaattatcctcagataccggtcaataaaccaagg
tgtccgttccactcttctagcagagatggctacatgcaaaacggatactacggctcttta
caaaactatacgcctagctcattgccaggttataaagaagataagagcgcgagagatcct
aagttcaacttagctcatattgagaaagagtttgaagtgtggaattgggattacagagct
gatgatagcgattactacacccaaccaggtgattactaccgctcattgccagctgatgaa
aaagaaaggttgcatgacactattggagagtctttagctcatgttacccataaggaaatt
gtggataagcaattggagcatttcaagaaagctgatcccaaatacgctgagggagttaaa
aaagctcttgaaaaacaccaaaaaatgatgaaagacatgcatggaaaagacatgcatcac
atgaaaaagaaaaagtaa

DBGET integrated database retrieval system