KEGG   Helicobacter pylori UM066: K751_05080Help
Entry
K751_05080        CDS       T02660                                 

Definition
(GenBank) catalase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
hpyu  Helicobacter pylori UM066
Pathway
hpyu00380  Tryptophan metabolism
hpyu00630  Glyoxylate and dicarboxylate metabolism
hpyu01110  Biosynthesis of secondary metabolites
hpyu01130  Biosynthesis of antibiotics
hpyu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hpyu00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    K751_05080
  Amino acid metabolism
   00380 Tryptophan metabolism
    K751_05080
Enzymes [BR:hpyu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     K751_05080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel
Motif
Other DBs
NCBI-ProteinID: AGL71573
UniProt: R4QBQ9
Structure
PDB: 

Jmol
Position
620592..622109
Genome map
AA seq 505 aa AA seqDB search
MVNKDVKQTTAFGAPVWDDNNVITAGPRGPVLLQSTWFLEKLAAFDRERIPERVVHAKGS
GAYGTFTVTKDITKYTKAKIFSKVGKKTECFFRFSTVAGERGSADAVRDPRGFAMKYYTE
EGNWDLVGNNTPVFFIRDAIKFPDFIHTQKRDPQTNLPNPDMVWDFWSNVPESLYQVTWV
MSDRGIPKSFRHMDGFGSHTFSLINAKGERFWVKFHFLTMQGVKHLTNEEAAEIRKHDPD
SNQRDLFDAIARGDFPKWKLSIQVMPEEDAKKYRFHPFDVTKIWYLKDYPLMEVGIVELN
KNPENYFAEVEQAAFTPANVVPGIGYSPDRMLQGRLFSYGDTHRYRLGVNYPQIPVNKPR
CPFHSSSRDGYMQNGYYGSLQNYTPSSLPGYKEDKSARDPKFNLAHIEKEFEVWNWDYRA
DDSDYYTQPGDYYRSLPADEKERLHDTIGESLAHVTHKEIVDKQLEHFKKADPKYAEGVK
KALEKHQKMMKDMHGKDMHHMKKKK
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggttaataaagatgtgaaacaaaccactgcttttggcgctcccgtttgggatgacaac
aatgtgattacggctggccctagaggtcctgttttattacaaagcacttggtttttggaa
aagttagcggcatttgatcgagaaagaatccctgaaagggtggtgcatgctaaaggaagc
ggagcttatggcactttcaccgtgactaaagacatcactaaatacactaaagcgaaaatt
ttctctaaagtgggcaaaaaaacagaatgctttttcagattttctactgtggcaggggaa
agaggcagtgcggatgcagtgagagaccctagaggttttgcgatgaagtattacactgaa
gaaggtaactgggatttggtagggaacaacacgcctgttttctttatccgtgatgcgatc
aaattccctgatttcatccacactcaaaaacgagatcctcaaaccaatttgcctaacccc
gacatggtatgggatttttggagtaatgttcctgaaagcttgtatcaagtaacatgggtt
atgagcgataggggtattcctaaatctttccgccacatggatggttttggcagccacact
ttcagcctcatcaacgcgaaaggcgaacgcttttgggtgaaattccactttttaaccatg
caaggcgtgaagcacttgactaatgaagaagccgcagaaatcagaaagcatgatcctgat
tccaatcaaagggatttattcgatgcgatcgctagaggggatttcccaaaatggaaattg
agcattcaagtgatgccagaagaagatgctaaaaagtatcgattccatccgtttgatgtg
actaaaatttggtatctcaaagattatccattgatggaagtgggtattgtagagttgaat
aaaaatcctgaaaactatttcgcagaagtggagcaagcggcattcactccggctaatgtc
gttcctggaattggctatagccctgataggatgttgcaagggcgcttgttctcttatggg
gacacacaccgctaccgcttaggggttaattatcctcagataccggtcaataaaccaagg
tgtccgttccactcttctagcagagatggctacatgcaaaacggatactacggctcttta
caaaactatacgcctagctcattgccaggttataaagaagataagagcgcgagagatcct
aagttcaacttagctcatattgagaaagagtttgaagtgtggaattgggattacagagct
gatgatagcgattactacacccaaccaggtgattactaccgctcattgccagctgatgaa
aaagaaaggttgcatgacactattggagagtctttagctcatgttacccataaggaaatt
gtggataagcaattggagcatttcaagaaagctgatcccaaatacgctgagggagttaaa
aaagctcttgaaaaacaccaaaaaatgatgaaagacatgcatggaaaagacatgcatcac
atgaaaaagaaaaagtaa

DBGET integrated database retrieval system