KEGG   Helicobacter pylori UM066: K751_06280Help
Entry
K751_06280        CDS       T02660                                 

Definition
disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hpyu  Helicobacter pylori UM066
Brite
Enzymes [BR:hpyu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     K751_06280
Secretion system [BR:hpyu02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   K751_06280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
379521..380318
Genome map
AA seq 265 aa AA seqDB search
MILRASVLSALLLVGLGATPKHSVSANDKRMQDNLVSVIEKQTNKKVRILEIKPLKSSQD
LKMVVIEDPDTKYNIPLVVSKDGNLVIGLSNIFFSNKSDDVQLVAETNQKVQALNATQQN
SAKLNAIFNEIPADYAIELPSTNAKNKDKILYIVSDPMCPHCQKELTKLRDHLKENTVRM
VVVGWLGVNSAKKAALIQEEMAKARARGASVEDKISILEKIYSTQYDINAQKEPEDLRTK
VENTTKKIFESGVIKGVPFLYHYKA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgatactaagagcgagtgtgttgagtgcgttacttcttgtaggcttaggggcaacccct
aaacattcagtttcggctaatgacaaacggatgcaggataatttagtgagcgtgattgaa
aaacaaaccaataaaaaggtgcgtattttagaaatcaagcctttaaaatccagccaggat
ttaaaaatggtcgttattgaagatccggacactaaatacaatattccgcttgtagtgagt
aaggatggtaatttagtcatagggcttagcaatatcttttttagtaataaaagcgatgat
gtgcaattggtcgcagaaactaatcaaaaagtccaagcccttaacgccacccaacaaaac
agcgcgaaattgaacgctatttttaatgaaataccggctgattatgcgatagagttgccc
tctactaacgctaaaaataaggataaaatcctttatattgtttctgatcccatgtgccct
cattgccaaaaagagctcactaaactcagggatcacttgaaagaaaacaccgtgagaatg
gttgtagtggggtggcttggagtcaattcagctaaaaaagcggctttgattcaagaagaa
atggcgaaagctagggctaggggagcgagcgtggaagataaaatctctatccttgaaaag
atttattccacccaatacgatattaacgcccaaaaagagcctgaagatttgcgcactaaa
gtggaaaataccactaaaaagatttttgaatctggcgtgattaagggtgtgcctttctta
taccattataaggcatga

DBGET integrated database retrieval system