KEGG   Helicobacter pylori UM066: K751_07070Help
Entry
K751_07070        CDS       T02660                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hpyu  Helicobacter pylori UM066
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hpyu00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    K751_07070
Enzymes [BR:hpyu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     K751_07070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(96965..97663)
Genome map
AA seq 232 aa AA seqDB search
MLTQALYYFIIYLLLKKLVIMLNMNTHTRGIDSNLIHSLQSISLSMFRKGFFGLYQGSIS
ARIGANQFVINKRNAVFDQLNENTLLVLHDKIDYRWKEASLDSPIHASVYREFLDAKFIA
YARPPYSLAYSLRHNRLLPRDYLGYRSLGEEIVIFNPKDYDSWQERADTEILCQLQESKK
YFVFIKGCGIFAYHRELSKLMEVFDLIENSCKVLRLGDLMDYCYNDDPRLSV
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
ttgcttacgcaagctctttactattttattatttatcttttattaaaaaaacttgttatc
atgctaaacatgaacacacacacaagaggcattgacagcaatctgattcattcgctccaa
agcatttcattatccatgtttagaaagggtttttttgggctttatcaaggctccatttca
gcacgcattggtgcaaatcagtttgtgatcaacaaaagaaacgctgtttttgatcaattg
aatgaaaacaccttgttggttttgcatgacaagatcgattaccgctggaaagaagcgagt
ctggattcgcccattcatgcgagcgtgtatagggagtttttggacgctaaattcatcgct
tatgcgcgccctccttatagtttggcgtattccttgcgccataaccgattgctccctaga
gattatttagggtatcgttctttgggcgaagaaatcgttatttttaaccccaaagactat
gacagctggcaagaaagagcggatacagaaattttatgtcaactgcaagagagcaaaaaa
tattttgttttcattaaggggtgcgggatttttgcctaccacagagagctttctaaactc
atggaagtttttgatttgattgaaaactcatgcaaggttttacgactgggcgatttaatg
gattattgctataatgatgatccacgattgagcgtgtaa

DBGET integrated database retrieval system