KEGG   Helicobacter pylori 52: HPKB_0111Help
Entry
HPKB_0111         CDS       T01898                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
hpz  Helicobacter pylori 52
Pathway
hpz00260  Glycine, serine and threonine metabolism
hpz00750  Vitamin B6 metabolism
hpz01100  Metabolic pathways
hpz01110  Biosynthesis of secondary metabolites
hpz01120  Microbial metabolism in diverse environments
hpz01230  Biosynthesis of amino acids
Module
hpz_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hpz00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPKB_0111
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HPKB_0111
Enzymes [BR:hpz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HPKB_0111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: ACX98732
UniProt: D0K217
Position
complement(109548..111008)
Genome map
AA seq 486 aa AA seqDB search
MPFAPTRSLKEKKIDFIEAILNPNAPKGGLYTLEHFETLQWQDCLNLSYNELVECVFECL
GLEIPKGLLTSALKRYENFDNPKNPAPIFALNERLFVQELYHGPSLAFKDMALQPLASLF
SNLAVGKNEKYLMLVSTSGDTGPATLESLAGMPNVFVVCLYPKDGTSLVQKLQMVTQSAS
NLKVFGISGDFDDAQNALKNLLKDDDFNGALKARQLKLSVANSVNFGRIAFQIVYHIWGF
LELYKKGAINSKEKITLAIPSGNFGNALGAFYAKKMGLNIAKIKVVTNSNDVLREFIETG
RYDLTHRSLKQTYSPAMDILKSSNVERVLFDLFGFERTLELMQALEEEKFYALKHKELAL
LQEHFSCASCSDEACLKTIQEVYAEHQYLIDPHTATALNASLKTNEKTLVSATASYEKFP
RTTLLALNEQKKNDNDKTALETLKNSYNTPDSQRLDDLFEKGIKHQEVLKLNEIKSSILL
WLENTH
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgccttttgcccccactcgttctttgaaagaaaaaaagattgattttattgaagcgata
ttaaaccccaacgccccaaaaggtgggctttacactttagagcattttgaaacattacaa
tggcaggattgcttgaatctgagctataacgagctggtagaatgcgtgtttgagtgcttg
ggattagagattcctaagggtttattgacaagcgctttaaaacgctatgaaaattttgat
aaccctaaaaatccagcccctatttttgcactcaatgaaaggctttttgtccaagagctc
taccatgggcctagtttggcgtttaaagacatggcactacagcctttagcgagcttgttt
tctaatctagcggtaggaaaaaatgaaaagtatttaatgctcgtttctaccagtggcgat
accggtcctgcgactttagaaagtttggcgggcatgcctaatgtttttgtggtgtgttta
taccccaaagacggcacaagtttagtccaaaaactccaaatggttacccaaagcgctagc
aatttaaaggtctttgggatcagtggggattttgatgatgcgcaaaacgcgctcaaaaac
cttttaaaagacgatgattttaacggcgctttaaaagcgcgccaactaaaattaagcgtg
gccaattccgtgaattttgggcgcatcgcttttcaaatcgtctatcatatttggggcttt
ttagaattgtataaaaaaggcgcaatcaattctaaagaaaaaatcaccctagccatacct
agcggtaattttgggaacgctttaggggcgttttatgccaaaaaaatgggcttgaatatt
gctaaaatcaaggttgtaaccaacagcaatgatgttttaagggagtttatagaaacaggg
cgttacgatttaacccatcgttctttaaagcaaacttactcgccggctatggatatttta
aaaagctctaatgtggaaagggtgctttttgatctctttgggtttgaacgcacgctagaa
ttgatgcaagctttagaagaagagaaattttacgcattaaagcataaagaattagccctt
ttgcaggagcatttttcttgcgcgagctgctcagatgaagcttgtttgaaaaccatccaa
gaagtttatgcagagcaccaatacctgattgacccccacaccgccaccgctttaaacgcc
agcttgaaaaccaatgaaaaaacccttgtttctgccaccgcctcttatgaaaaattccct
agaaccacccttttagccctaaacgagcaaaagaaaaacgataacgacaaaaccgcccta
gaaacgcttaaaaacagctacaataccccagatagccaacgccttgatgatttatttgag
aaaggaatcaagcaccaagaagttttaaaactcaatgaaatcaaatcttctatccttttg
tggctagaaaacacgcattaa

DBGET integrated database retrieval system