KEGG   Helicobacter pylori 52: HPKB_0124Help
Entry
HPKB_0124         CDS       T01898                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hpz  Helicobacter pylori 52
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hpz00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HPKB_0124
Enzymes [BR:hpz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     HPKB_0124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
126185..126823
Genome map
AA seq 212 aa AA seqDB search
MLNMNTHTRGIDSNLIHSLQSISLSMFRKGFFGLYQGSISARIGTNQFVINKRNAVFDQL
NENTLLVLHDKIDYRWKEASLDSPIHASVYREFLDAKFIAYARPPYSLAYSLRHNRLLPR
DYLGYRSLGEEISIFNPKDYDSWQERADTEILRQLQESKKYFVFIKGCGIFAYHRELSKL
MEVFDLIENSCKVLRLGDLMDYCYNDDPRLSV
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgctaaacatgaacacacacacaagaggcattgacagcaatctgattcattcgctccaa
agcatttcattatccatgtttagaaagggtttttttgggctttatcaaggctctatttca
gcgcgcattggcacgaatcaatttgtgatcaataaaagaaacgctgtttttgatcaattg
aatgaaaacaccttattggttttgcatgataagattgattaccgctggaaagaagcgagc
ctggattcgcccattcatgcgagcgtgtatagggagtttttggacgctaaattcatcgct
tatgcgcgccctccttatagtttggcgtattccttgcgccataaccgattgctccctaga
gattatttagggtatcgttctttgggcgaagaaatttccatttttaaccccaaagactat
gacagctggcaagaaagagcggatacagaaattttacgccaactgcaagagagcaaaaaa
tattttgttttcattaaggggtgtgggatttttgcctaccacagagagctttctaaactc
atggaagtttttgatttgattgaaaactcatgcaaggttttacgactgggcgatttaatg
gattattgctataatgatgatccacgattaagcgtgtga

DBGET integrated database retrieval system