KEGG   Helicobacter pylori 52: HPKB_0225Help
Entry
HPKB_0225         CDS       T01898                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
hpz  Helicobacter pylori 52
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hpz00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPKB_0225
Enzymes [BR:hpz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     HPKB_0225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
229780..230886
Genome map
AA seq 368 aa AA seqDB search
MVVLGSTGSIGKNALKIAKKFKVEIEALSCGKNIALINEQIKVFKPKKVAILDPNDLNTL
EPFGAKVFVGLEGIDAMIEECVSNLVINAIVGVAGLRASFKSLQTNKKLALANKESLVSA
GHLLDISQITPIDSEHFGLWALLQNKALKPKSLIISASGGAFRDTPLELIPVQNAQNALK
HPNWSMGSKITIDSASMVNKLFEILETYWLFGASLKIDALIERSSIVHALVEFEDNSIIA
HLASADMQLPISYAINPKLASLSASIKPLDLYALSAIKFEPISMERYTLWRYKDLLLENP
KLGVVLNASNEVAIEKFLNKEIAFGGLIKTISQALESYAKTPFKLSNLDEVLALDKEVRE
RFKNVARV
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggttgttttaggaagcaccggctctattgggaaaaacgccctaaaaatcgcaaaaaaa
ttcaaggtagaaatagaagccttgagctgtgggaaaaatatcgctttaatcaatgagcaa
atcaaagttttcaaacccaagaaagtagcgatcttagatcctaacgatttgaatacttta
gagccttttggcgcaaaagtgtttgtagggttagagggcattgatgcgatgatagaagag
tgcgtttcaaatttagtcattaacgccattgtgggcgtggcaggattaagggcgagcttt
aaaagcttacaaactaacaaaaaactagccctagcgaataaagagagtttggtgagcgcg
gggcatttattagacatttcacaaatcacgcccattgacagcgagcattttggtttgtgg
gcgttgttgcaaaacaaggctttaaagcctaaatccttaatcattagcgcgagtgggggg
gctttcagggacacgcctttagaactcattcctgttcaaaatgcacaaaacgcgctcaag
caccctaattggagcatgggatctaaaatcaccattgattcagcgagcatggtcaataag
ctttttgaaatcctagaaacttattggcttttcggcgcgtctttaaagattgatgcgctg
attgaaagaagttctatcgtgcatgctttggtggagtttgaagataactctatcatcgcg
catttggcaagcgcagacatgcaattacccataagctatgccattaaccctaaattagct
tctttgagcgcgtctatcaagcccctagatttatacgctttaagcgcgattaaatttgaa
cccattagcatggagcgctacactttgtggcgttataaagacttgttgttggaaaaccca
aagcttggcgtggtgctgaatgcgagcaatgaggtggcgatagagaagtttttgaacaaa
gagatcgcttttggtgggcttatcaaaaccatttctcaagccctagaatcatacgctaaa
acgcctttcaaactctctaatttagatgaagtgctggcgttggataaagaagttagggag
cgttttaaaaatgtagcgagagtgtag

DBGET integrated database retrieval system