KEGG   Helicobacter pylori 52: HPKB_0241Help
Entry
HPKB_0241         CDS       T01898                                 

Definition
disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hpz  Helicobacter pylori 52
Brite
Enzymes [BR:hpz01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     HPKB_0241
Secretion system [BR:hpz02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   HPKB_0241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
246312..247109
Genome map
AA seq 265 aa AA seqDB search
MILRASVLSALLLVGLGAAPKHSVSANDKRMQDNLVSVIEKQTNKKVRILEIKPLKSSQD
LKMVVIEDPDTKYNIPLVVSKDGNLIIGLSNIFFSNKSEDVQLVAETNQKIQALNATQQN
SAKLNAIFNEIPADYAIELPSTNAKNKDKILYIVSDPMCPHCQKELTKLRDHLKENTVRM
VVVGWLGANSAKKAALIQEEMAKARARGASVEDKISILEKIYSTQYDINAQKEPEDLRTK
VENTTKKIFESGMIKGVPFLYHYKA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgatattaagagcgagtgtgttgagtgcgttacttcttgtaggcttaggggcagcccct
aaacattcagtttcagctaatgacaaacggatgcaggataatttagtgagcgtgattgaa
aaacaaaccaataaaaaggtgcgtattttagaaatcaaacctttaaaatccagccaggat
ttaaaaatggtcgttattgaagatccggacactaaatacaatattccgcttgtagtgagt
aaggatggtaatttaatcatagggcttagcaatatcttttttagcaataaaagcgaagat
gtgcaattagtcgcagaaaccaatcaaaaaatccaagcccttaacgccacccaacaaaac
agcgcgaaattgaacgctatttttaatgaaataccggctgattatgcgatagaattgccc
tctactaacgctaaaaataaggataaaatcctttatattgtttctgatcccatgtgtccg
cattgccaaaaagagctcactaaactcagggatcacttgaaagaaaacaccgtgagaatg
gttgtggtggggtggcttggggccaattcagctaaaaaagcggctttgatccaagaagaa
atggcgaaagctagggctaggggagcgagcgtggaagataaaatctctatccttgaaaag
atttattccacccaatacgatattaacgctcaaaaagagcctgaagatttacgcactaaa
gtggaaaataccactaaaaagatttttgaatctggcatgattaagggtgtacctttctta
taccattataaggcatga

DBGET integrated database retrieval system