KEGG   Helicobacter pylori 52: HPKB_0287Help
Entry
HPKB_0287         CDS       T01898                                 

Definition
hypothetical protein
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hpz  Helicobacter pylori 52
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hpz01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:hpz00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
289751..290308
Genome map
AA seq 185 aa AA seqDB search
MQEIRILENLQKSLALKEGMLSYEMLGKSLSYNPYLPRVIPQIKDCVFVTPDEVLGKLLE
ENTRTECVIVNFKGLYEIGAPSVFDLEVLGLLRRHASSLIVHQDLFISHYQLLESLVQGS
DGVILDEELLKEDLKGMVEFAWRLGLSVFVETHKKDYTHLKDLGVLGVLEKVPHSQNQKK
IVFLD
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaataaggattttagaaaatttacaaaaaagcttggccttaaaagagggcatg
ctttcttatgaaatgctaggtaaaagcctgtcgtataacccttacttgcctagagtcatt
cctcaaattaaagattgtgtttttgtaacccctgatgaggttttaggaaagcttttggaa
gaaaacacccgcacagaatgcgtcattgtcaatttcaaaggattatacgaaataggcgcg
ccaagcgtgtttgatttagaagttttggggttattgcgccgccatgcgagctctttgatt
gtccatcaggatcttttcatcagccattaccagctcttagaatcgcttgttcaaggctct
gatggggtcattttagacgaagagcttttgaaagaagatttaaagggaatggtagaattc
gcttggcgtttgggcttaagcgtgtttgtagaaacccacaaaaaagactacacccattta
aaagatttaggagttttaggcgtgctagaaaaagtcccccattctcaaaatcaaaaaaaa
atagtttttttagattga

DBGET integrated database retrieval system