KEGG   Helicobacter pylori 52: HPKB_0369Help
Entry
HPKB_0369         CDS       T01898                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
hpz  Helicobacter pylori 52
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:hpz00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:hpz00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
380323..381246
Genome map
AA seq 307 aa AA seqDB search
MPKKCRHLLQTSDLSLDEIKLLLKKASVYANDFNAVSLETKEKMQNKIIVALFFENSTRT
VSSFEIASLRLGAKIVKLNMQTSSASKGETLTDTFKNIHAMQPDAIITRHAFSSAPFKLA
EFSQCPLINAGSGVSAHPTQALLDLLTLYQHFGSLENLKGKKIAFIGDVRNSRVANSNIK
LLQRLGLEIMLCAPSSMLPSVSLKTTHNIEEAIEFADILMSLRTQTERHNAPIFASLKDY
GNAYCITQKRLEAHAKNKEIIILHPGPVHRDIDIESAVLEDKRSKVLEQVKNGVAMRMAV
LEFLLLD
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaaaatgccgacacttgctccaaaccagcgatttaagcctagatgaaatcaag
cttttattaaaaaaagcgagcgtttatgcgaacgattttaacgccgtatctttagaaacg
aaagaaaaaatgcaaaataaaatcatcgtggctttattttttgaaaattccaccagaacg
gtgtctagttttgaaatcgcaagcttgagattgggggcaaaaatcgtgaaattaaacatg
caaacaagctccgcttcaaagggtgaaaccctaacagacacttttaaaaatatccatgcc
atgcagcctgacgctatcatcacacggcatgctttttcaagcgcgccttttaaattagcc
gaattttcacaatgccccttgattaacgcaggaagcggcgtaagcgctcatcctacccaa
gcgttattggacttgctcaccctttatcagcattttggcagtttagaaaatttaaaaggg
aagaaaatcgctttcataggcgatgtgagaaattccagagtggctaatagcaacattaaa
ttactccaaaggctagggcttgagatcatgctgtgcgctccaagctccatgctccctagc
gtttctttaaaaacgacgcacaacattgaagaagcgatagaatttgcagacattttaatg
agtttgaggacccaaaccgaacggcacaacgcgcccatttttgcgagcttgaaagattat
ggcaacgcttattgcatcacccaaaaacgcctagaggctcacgctaaaaataaagagatc
attattttacacccaggcccggtgcatagggatattgatatagaaagtgcggtgttagaa
gataagcgatctaaagttttagagcaggtcaaaaacggcgtggcgatgcgcatggcggtg
ttggagtttttgctgttagattaa

DBGET integrated database retrieval system