KEGG   Helicobacter pylori 52: HPKB_0416Help
Entry
HPKB_0416         CDS       T01898                                 

Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
hpz  Helicobacter pylori 52
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HPKB_0416
Enzymes [BR:hpz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     HPKB_0416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
427033..427524
Genome map
AA seq 163 aa AA seqDB search
MMREILTSRFFPSLFKKRLDFSNRVVLGLGSNLKNPLKILKNCFLYFKNHSKIGKIFSSP
VYINPPFGYTKQPNFYNATIILKTSLSLRHFFALVFYIERRFGRKRKRDFKDAPRTLDID
IIAFNQVILRQKDLTLPHLKWSERDSVLVPLALQQILFKKGEW
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
gtgatgcgagagatccttactagccgctttttccctagcctttttaaaaaaaggcttgat
ttttctaacagggtggttttggggcttggatctaaccttaaaaatcctttaaaaatatta
aaaaattgttttttatattttaaaaatcatagtaaaatcgggaaaattttttcttcgcct
gtttatatcaacccgccttttggttacactaagcaacctaacttttataacgctacgatt
atccttaaaacatctttaagtttgcgccatttttttgctctggttttttatatagaaagg
cgttttgggcgcaaaagaaagcgcgattttaaagacgctccaagaactttagacattgat
attatcgctttcaatcaagtcattttaagacagaaggatttgactttacctcatcttaaa
tggagtgaaagggattcggtgttagtgccgttggctttgcaacaaattctttttaaaaaa
ggggagtggtga

DBGET integrated database retrieval system