KEGG   Helicobacter pylori 52: HPKB_0698Help
Entry
HPKB_0698         CDS       T01898                                 

Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hpz  Helicobacter pylori 52
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hpz00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HPKB_0698
   00052 Galactose metabolism
    HPKB_0698
   00500 Starch and sucrose metabolism
    HPKB_0698
   00520 Amino sugar and nucleotide sugar metabolism
    HPKB_0698
Enzymes [BR:hpz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HPKB_0698
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(724361..725182)
Genome map
AA seq 273 aa AA seqDB search
MIKKCLFPAAGYGTRFLPITKTIPKEMLPIVDKPLIQYAVEEAMEAGCEVMAIVTGRNKR
SLEDYFDTSYEIEHQIQGTNKENALKSIRNIIEKCCFSYVRQKQMKGLGHAILTGEALIG
NEPFAVILADDLCISHDHPSVLKQMISLYQKYQCSIVAIEEVALEEVSKYGVIRGEWLED
GVYEIKDMVEKPSQEDAPSNLAVIGRYILTPDIFEILSETKPGKNNEIQITDALLTQAKR
KRIIAYQFKGKRYDCGSVEGYIEASNAYYKKRL
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaatgcctttttcctgccgctggctacggcacgcgctttttgccgatcact
aaaaccattcctaaagaaatgctgcccattgtggataagcctttaatccaatacgctgta
gaagaagcgatggaagcaggctgtgaagtgatggcgattgttacaggcagaaacaagcgc
agtttagaagattattttgacacgagctatgaaatagagcatcaaatccaaggcactaac
aaagaaaacgccctaaaaagcattcgtaacattatagaaaaatgctgtttttcctatgtg
cgccaaaagcaaatgaaaggcttagggcatgcgattttaaccggagaagccctcataggc
aatgagccttttgcggtgattttagccgatgacttatgcataagccatgatcacccaagc
gtgctaaagcaaatgatttccttgtatcaaaaataccaatgctccattgtagccattgaa
gaggtggcgctagaagaagtttcaaaatacggcgtgatcaggggcgaatggttagaagat
ggggtgtatgagattaaagacatggtggaaaaaccaagccaagaagacgccccaagcaat
ctagccgtgatagggcgctacattctaaccccggatatttttgaaattttaagcgagacg
aaaccgggtaaaaacaatgaaatccagatcacagacgccttactcactcaagccaaaaga
aaacgaatcatcgcctaccaattcaaaggcaaacgatacgattgcgggagcgtggaaggc
tatattgaagcgagtaacgcttattataaaaaacgcttgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system