KEGG   Helicobacter pylori 52: HPKB_0838Help
Entry
HPKB_0838         CDS       T01898                                 

Definition
phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
hpz  Helicobacter pylori 52
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpz00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    HPKB_0838
   00565 Ether lipid metabolism
    HPKB_0838
   00590 Arachidonic acid metabolism
    HPKB_0838
   00591 Linoleic acid metabolism
    HPKB_0838
   00592 alpha-Linolenic acid metabolism
    HPKB_0838
Enzymes [BR:hpz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     HPKB_0838
    3.1.1.32  phospholipase A1
     HPKB_0838
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(887634..888701)
Genome map
AA seq 355 aa AA seqDB search
MKSILLFMIFVVCQLEGKKFSQDNFKVDYNYYLRKQDLHIIKTQNDLSNAWYLPPQKAPK
EHSWVDFAKKYLNMMDYLGTYFLPFYHSFTPIFQWYHPNINPYQRNEFKFQISFRVPVFR
HILWTKGTLYLAYTQTNWFQIYNNPQSAPMRMINFMPELIYVYPINFEPFGGKIGKFSEI
WIGWQHISNGVGGAQCYQPFNKEGNPENQFPGQPVIVKDYNGQKDVRWGGCRSVSAGQRP
VFRLVWEKGGLKIMVAYWPYVPYDQSNPNLIDYMGYGNAKVDYRRGRHHFELQLYDIFTQ
YWRYDRWHGAFRLGYTYRINPFVGIYAQWFNGYGDGLYEYDVFSNRIGVGIRLNP
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcattttgctctttatgatttttgtagtttgtcagttagaaggcaaaaaattt
tcacaagataattttaaggtggattataactactatttgcgcaaacaggatttgcacatc
attaaaacgcaaaacgatttgtccaatgcttggtatctccctccacaaaaagcccccaaa
gaacattcttgggtggattttgctaaaaaatatttaaacatgatggattatctaggcact
tattttttgcctttttatcatagtttcacccccatttttcaatggtaccatcccaatatc
aacccgtatcaacgcaatgaatttaagttccagattagttttagagtgcctgtatttagg
catattctttggactaaaggcacgctttatctggcttatactcaaactaactggtttcaa
atttacaataacccccaatccgctcccatgcgaatgatcaatttcatgcctgaactcatt
tatgtttatcctattaattttgaaccttttgggggtaaaatagggaaattttctgagatt
tggataggttggcagcacatttctaatggtgtgggaggcgcgcaatgctaccagcctttt
aacaaagaaggcaatcctgaaaaccagtttcccggacaacctgtaatcgttaaagattat
aacgggcaaaaagatgtgcgctggggggggtgccgttcggtgagcgcggggcaacgccct
gtgtttcgtttggtgtgggaaaagggaggcttgaaaatcatggtcgcttattggccctat
gtcccttatgatcaatccaaccctaatttgattgattacatggggtatggtaacgctaaa
gttgattacaggagagggcgccatcattttgaattgcaactttatgatattttcacgcaa
tactggcgttatgatcgctggcatggagctttccgcttaggctatacctaccgcattaac
ccttttgtggggatttatgcgcagtggtttaacggctatggcgatggcttgtatgaatac
gatgttttttccaatcgtataggggtaggaatacgcttaaacccttaa

DBGET integrated database retrieval system