KEGG   Helicobacter pylori 52: HPKB_0851Help
Entry
HPKB_0851         CDS       T01898                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase motor protein
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
hpz  Helicobacter pylori 52
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hpz00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HPKB_0851 (ruvA)
Enzymes [BR:hpz01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     HPKB_0851 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(900967..901518)
Genome map
AA seq 183 aa AA seqDB search
MIVGLIGVVEKISALEVHIEVQGVVYGVQVSMRASALLQMGQKARLKILQVIKEDAHLLY
GFLEESEKILFERLLKINGVGGRIALAILSSFSPNEFESIIATKEVKRLQQVPGIGKKLA
DKIMVDLIGFFIQDETSPACNEVFLALESLGFKSTEINKVLKTLKPNLSIEAAIKEALQQ
LRS
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgatagtgggtttgataggggttgtggaaaaaatctctgctttagaagtgcatatagaa
gtgcaaggggttgtttatggggtgcaagtttctatgcgcgcttctgctttgctccaaatg
ggccaaaaagcgcgtttgaaaatcttacaagtgatcaaagaagatgcgcatcttttatac
gggtttttagaagagagcgaaaaaatcctctttgaaaggcttttgaaaatcaatggggta
ggggggcgtatcgctttagccattctttcaagcttttcgccgaatgaatttgaaagcatt
atcgccaccaaagaagtcaaaagactccagcaagtcccaggcattggcaaaaagctcgct
gataagatcatggtggatctcattggctttttcattcaagatgaaactagccctgcgtgc
aatgaagtctttttagccctagagagtttgggctttaaaagcaccgaaatcaataaagtg
ttaaaaaccctaaaacccaatctcagcatagaagcagcgattaaagaagccttacaacaa
ctgcgctcttaa

DBGET integrated database retrieval system