KEGG   Helicobacter pylori 52: HPKB_1033Help
Entry
HPKB_1033         CDS       T01898                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
hpz  Helicobacter pylori 52
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hpz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HPKB_1033 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPKB_1033 (glk)
   00052 Galactose metabolism
    HPKB_1033 (glk)
   00500 Starch and sucrose metabolism
    HPKB_1033 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    HPKB_1033 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HPKB_1033 (glk)
   00524 Butirosin and neomycin biosynthesis
    HPKB_1033 (glk)
Enzymes [BR:hpz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HPKB_1033 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1095222..1096232
Genome map
AA seq 336 aa AA seqDB search
MPKTETYPRLLADIGGTNARFGLEVAPRQIECIEVLPCKDFESLSDAVRFYLSKCKESLK
LHPIYGSFAVATPIMGDFVQMTNNHWTFSIETTRQCLNLKKLLVINDFVAQAYAISAMQE
NDLAQIGGIKCEINAPKAILGPGTGLGVSTLIQNGDGSLKVLPGEGGHVSFAPFDDLEIL
VWQYARSKFNHVSAERFLSGSGLVLIYEALSKRKGLEKVAKLSKAELTPQIISERALNGD
YPICRLTLDTFCSMLGTLAADVALTLGARGGVYLCGGIIPRFIDYFKTSPFRARFETKGR
MGAFLASIPVHVVLKKTPGLNGAGIALENYLLHDKI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaactgaaacttacccaagactattagccgatattggcggcacgaacgcacgc
tttggtttagaagtcgccccacgacagattgaatgcattgaagtcttgccatgcaaagat
tttgaaagcttgagcgatgcggtgcgattttacctttctaaatgcaaagaaagccttaaa
ctgcaccctatttatggctcttttgcggtggctacgcccattatgggggattttgtccaa
atgactaacaaccactggactttttctattgaaacgacacggcaatgtttgaatttaaaa
aaattgcttgtcatcaacgattttgtcgcacaagcctatgccattagcgcgatgcaagaa
aacgatctggctcaaataggcgggattaagtgcgaaatcaacgctcctaaagcgatttta
gggccaggaactgggcttggggtaagcactcttatccaaaatggcgatggctctttaaaa
gtcttacccggtgaaggggggcatgtgagcttcgccccttttgatgatttagaaatttta
gtgtggcaatacgcccgctctaaattcaatcatgtgagcgcggaaaggtttttgagcggg
agcggtttggtgttgatttatgaagccctgtctaaacgcaaaggcttagaaaaagtggcg
aagttaagcaaggctgaattaaccccacaaatcattagtgaacgcgctttgaatggggat
taccctatatgccgattgactttggacactttttgttccatgctaggcacgctcgctgct
gatgtggctctcactttgggggctagggggggcgtgtatttgtgtggggggattatcccg
cgattcattgattattttaaaacttcgccctttagagcgcgttttgaaacgaaagggcgc
atgggagcgtttctcgcttctatccctgtgcatgtcgtgctgaaaaaaaccccggggctt
aacggggcgggcattgcgttagagaattatctactgcatgataagatatag

  All links  
No link information was found.   
DBGET integrated database retrieval system