KEGG   Helicobacter pylori 52: HPKB_1042Help
Entry
HPKB_1042         CDS       T01898                                 

Gene name
porB
Definition
(GenBank) pyruvate ferredoxin oxidoreductase, beta subunit
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
hpz  Helicobacter pylori 52
Pathway
hpz00010  Glycolysis / Gluconeogenesis
hpz00020  Citrate cycle (TCA cycle)
hpz00620  Pyruvate metabolism
hpz00640  Propanoate metabolism
hpz00650  Butanoate metabolism
hpz00680  Methane metabolism
hpz01100  Metabolic pathways
hpz01120  Microbial metabolism in diverse environments
hpz01130  Biosynthesis of antibiotics
hpz01200  Carbon metabolism
Module
hpz_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hpz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPKB_1042 (porB)
   00020 Citrate cycle (TCA cycle)
    HPKB_1042 (porB)
   00620 Pyruvate metabolism
    HPKB_1042 (porB)
   00640 Propanoate metabolism
    HPKB_1042 (porB)
   00650 Butanoate metabolism
    HPKB_1042 (porB)
  Energy metabolism
   00680 Methane metabolism
    HPKB_1042 (porB)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPKB_1042 (porB)
Enzymes [BR:hpz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPKB_1042 (porB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C Myb_DNA-bind_4
Motif
Other DBs
NCBI-ProteinID: ACX99608
UniProt: D0K0I8
Position
1104616..1105560
Genome map
AA seq 314 aa AA seqDB search
MVKEVKTLKGFSQSAEKFQGSHLLCPGCGHGIIVREVLNAVDGPIVLGNSTGCLEVCSAV
YPHTSWDVPWIHIGFENGSTAISGVEAMYKALVNKGRYQGQKPKFVAFGGDGASYDIGLQ
FISGCMERGHDMTYICLDNENYANTGGQRSGSTPLGASTSTTPSGSVSFGKKEKKKDIVN
IMASHGVPYVAQLSPNKWKDMNKKIKTALDTEGPCFINALSPCTTEWKFESNKTIELADM
AVDSLMFPLFEIFNGKELKITYRPRNIIPVRDYLGAQKRFKHLFKKENEHIIEELQKDVN
ERWEYLQRREEAKV
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagaagtcaaaacactcaaaggttttagccaaagcgctgaaaaattccaaggt
tcacacttgctttgtccgggttgtgggcatggcattattgtgcgcgaagttttaaacgct
gtagatgggcctattgttttaggcaattctaccggttgtttagaggtatgctcggcggtg
tatccgcacacttcatgggatgtgccttggattcatattggttttgaaaatggctctacg
gcgatttcaggggtagaagcgatgtataaagcgctagtgaataagggtcgctatcaaggt
caaaaaccaaaatttgtggcgtttgggggcgatggggctagttatgatattggtcttcaa
ttcatcagcggttgcatggaaagagggcatgacatgacttacatttgcctggataatgaa
aactatgccaacaccggcggtcaaagaagtggctctacgccattaggggctagcacttct
accacgccatcaggatcggttagctttggtaaaaaagaaaagaaaaaagacatcgtcaat
atcatggcaagccatggggttccttatgtggcgcagctctcgcctaacaaatggaaagac
atgaacaaaaagattaaaaccgcactagacactgaagggccttgcttcatcaacgctctt
agcccatgcacgactgaatggaaatttgaatccaataaaaccattgaattagcagatatg
gctgtggatagcttgatgttccccctatttgagatctttaatggtaaggaattgaaaatc
acttaccgcccaagaaatatcattcctgtaagggattatttaggggctcaaaagcgcttc
aaacaccttttcaaaaaagaaaacgaacacattattgaagaattgcaaaaagatgtgaat
gagcgttgggaatacttgcaacgcagagaagaagctaaagtataa

DBGET integrated database retrieval system