KEGG   Helicobacter pylori 52: HPKB_1160Help
Entry
HPKB_1160         CDS       T01898                                 

Gene name
hemD
Definition
uroporphyrinogen III cosynthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hpz  Helicobacter pylori 52
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:hpz00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1227382..1228062
Genome map
AA seq 226 aa AA seqDB search
MREVVWVHSQRIAPYKTLILNELCYYPLELDPTPFNALIFTSKNAVFSLLETLKNSPKLK
ILQNIPAYALSEPTAKTLQDHHFKVAFIGEKAHGKEFVQEILPLLEKKSVLYLRAKEIAS
SLDTILLEHGIDFKQAVVYENKLKHLTLSEQNALKPKEKSVLIFTAISHAKAFLHYFEFL
ENYTAISIGNTTALYLQEQGIQSYIAKKPSLEACLELALSLRVKEC
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgagagaggttgtatgggtgcattctcaaagaatcgccccttataagactctcatttta
aatgaattgtgctactatcccttagaattagatccaaccccttttaacgctctcattttc
acctctaaaaatgcggtgttttccttgctagaaactctaaaaaacagccccaaactcaaa
attttacaaaacattcctgcttacgctttgagcgaacccaccgcaaaaactttacaagat
caccattttaaagtcgcctttataggggaaaaagcccatggtaaagagtttgttcaagaa
atccttcctttattggaaaaaaaaagcgttttgtatcttagggcaaaagagattgcctct
tctttagacaccattcttttagagcatggcattgatttcaagcaagccgttgtttatgaa
aacaagctcaaacatttgaccttaagcgaacaaaacgccctaaaacccaaagaaaagagc
gttcttatttttaccgctataagccatgcaaaagccttcttgcactattttgaattttta
gaaaattacaccgctataagcattggcaacacgaccgctctttatttacaagagcaaggc
attcaaagctatattgccaaaaagccttccttggaagcgtgtttagaactggctttgagt
ttgagggttaaggaatgttaa

DBGET integrated database retrieval system