KEGG   Helicobacter pylori 52: HPKB_1168Help
Entry
HPKB_1168         CDS       T01898                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hpz  Helicobacter pylori 52
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HPKB_1168 (folP)
Enzymes [BR:hpz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     HPKB_1168 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1233005..1234147
Genome map
AA seq 380 aa AA seqDB search
MILKRLNPDALKNALLKTGSEKIAQTHMYKKGVSFVFEIQHLPLSATLILKQEAISVGGD
FATPRDCILAKEPFYDGVLVVSANQLERLITKCHSQPFGLKNLAQELKSHLKSQKPNNPQ
IMAILNLTPDSFYEKSRFDSKKALEEIYQLLEKGITLIDIGAASSRPQSEIIDPKIEQDR
LKEILLEIKSQKLYQCAQFSIDTYHATTAQMALEHYFSILNDVSGFSSIKMLEVAKDYKP
TCILMHAQKTPKDMQENVFYHNLFDEMDRFFKEKLEVLEKYALQDIILDIGFGFAKLKEH
NLALIKHLSHFLKFKKPLLVGASRKNTIGLITGREVQNRLAGTLSLHLMALQNGASILRV
HDIDEHIDLIKVFKSLEETN
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgattttaaaacgccttaaccctgatgcactcaaaaatgcccttttaaaaaccggatca
gaaaaaatcgctcaaacccatatgtataaaaagggcgttagctttgtttttgaaatccaa
cacctgcccttaagcgcaacgctcattttaaaacaagaggccatcagcgttgggggcgat
ttcgccacgccaagagattgtattttagctaaagagcctttttatgatggggtgctagtt
gtgagcgctaaccagttagaacgccttattactaagtgccactcccaaccctttgggctt
aaaaatttagcgcaagaattaaaaagccaccttaaatcccaaaagcctaacaacccgcag
atcatggcaattttgaatctcacgccggatagcttctatgaaaaaagccggtttgatagc
aaaaaagcgcttgaagaaatctaccaattgctagaaaagggtatcacgctcattgatata
ggcgcggcgagttcaaggccacagagtgagatcattgatccaaaaatagagcaagatcgc
ttaaaagaaattttattagagatcaaatcccaaaaactctaccaatgcgctcaattcagc
atagacacctaccatgccacaaccgcccaaatggctttggagcattatttttccatcctt
aatgatgtgagcggttttagtagtattaaaatgctagaagtcgcaaaagattacaagccc
acttgcattttaatgcacgctcaaaaaacccccaaagacatgcaagaaaatgttttttac
cacaatctgtttgatgaaatggatcgcttctttaaggaaaaactagaggttttagaaaaa
tacgcgcttcaagatattattttagatattgggtttggattcgctaaattaaaagagcat
aatttagccttaatcaagcatttaagccacttcctcaaattcaaaaaacccttattggtg
ggagcgagtcgtaaaaacacgatcgggcttatcaccgggcgtgaagttcaaaaccggctc
gccggcactttaagtttgcatttaatggcgctgcaaaatggagcgagtattttaagagtg
catgacattgatgagcatatagacctcatcaaggtgtttaagagtttagaagaaacaaat
taa

DBGET integrated database retrieval system