KEGG   Helicobacter pylori 52: HPKB_1211Help
Entry
HPKB_1211         CDS       T01898                                 

Definition
hypothetical protein
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hpz  Helicobacter pylori 52
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hpz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPKB_1211
   00030 Pentose phosphate pathway
    HPKB_1211
   00051 Fructose and mannose metabolism
    HPKB_1211
   00052 Galactose metabolism
    HPKB_1211
   00500 Starch and sucrose metabolism
    HPKB_1211
   00520 Amino sugar and nucleotide sugar metabolism
    HPKB_1211
  Nucleotide metabolism
   00230 Purine metabolism
    HPKB_1211
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HPKB_1211
Enzymes [BR:hpz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     HPKB_1211
    5.4.2.8  phosphomannomutase
     HPKB_1211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1277163..1278539
Genome map
AA seq 458 aa AA seqDB search
MDISIFREYDIRGIYPTTLDEKNAFSIGVELGKIMRKYDKSVFVGHDARVHGRSLFEALS
AGLQSSGLKVYDLGLIPTPVAYFAAFNEIDNIQCPNSIMITGSHNPKEYNGFKITLNQNP
FYGKDIQALKDTLLNAKHEIKPLKETPKKVNALEAYQRYLIKDFKHLKNLKYKIALDFGN
GVGALGLEPILKALNIDFSSLYSDPDGNFPNHHPDPSEAKNLKDLETHMQKNAISIGFAF
DGDADRIAMLSSHHIYAGDELAILFAKRLHAQGITPFVIGEVKCSQVMYNTINTFGKTLM
YKTGHSNLKIKLKETHAHFAAEMSGHIFFKERYFGYDDALYACLRALELLLEQTPSDLES
TIKNLPYSYTTPEEKIAVSEEEKFEIIHSLQETLKNPPSHFPKIKEIISIDGVRVVFEHG
FGLIRASNTTPYLVSRFEGKDEATALEYKTALLNLLEK
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggacattagcatttttagagaatatgatattagaggcatttaccccaccactttagat
gaaaagaacgcctttagtatcggcgtggagttagggaaaatcatgcgaaaatacgataaa
agcgtgtttgtagggcatgacgccagggtgcatgggcgatcgctttttgaagctttgagc
gcggggttacaatcaagcggcttgaaagtgtatgatttagggctaatccccacaccggta
gcgtattttgcggcctttaatgaaatagataacatccaatgccccaattctatcatgatc
actggctctcacaaccccaaagaatacaacggctttaaaatcacgctcaatcaaaatccg
ttttatggcaaggacattcaagctttaaaagacacgcttttaaacgccaagcatgaaata
aaacccctaaaagaaacaccaaagaaagtcaatgccctagaagcgtatcagcgctatttg
atcaaggattttaaacatttaaaaaaccttaaatacaaaatcgccctggattttggtaat
ggcgtgggagcgttaggcttagagcctattttaaaggctttaaacattgattttagcagc
ctttatagcgatcctgatgggaatttccctaaccaccacccagaccctagcgaagcgaaa
aacctaaaagatttagaaacacacatgcaaaaaaacgctatttctataggctttgctttt
gatggcgatgcggacaggattgcgatgttaagctctcatcatatttatgcgggcgatgaa
ttagcgattttattcgctaaacgcttgcatgctcaaggcatcaccccctttgtgatcggc
gaagtcaaatgttctcaagtgatgtataacacgatcaatacttttggtaagacgctcatg
tataaaaccgggcatagcaatttaaaaatcaaactcaaagaaacccatgcgcattttgcg
gctgaaatgagcgggcatatcttttttaaagaacgctattttggctatgatgacgctctt
tatgcatgcttaagggctttagaattattgcttgaacaaaccccaagcgatttggaaagc
accattaaaaacctcccctattcctacaccacgcctgaagaaaaaatcgccgtgagcgaa
gaagaaaaatttgaaatcattcatagcctgcaagaaacgcttaaaaacccgccaagtcat
ttccctaaaatcaaagaaatcatcagcattgatggcgtgagggtggtttttgaacatggt
tttgggcttattcgcgcaagcaacaccaccccgtatttagtcagccgctttgaaggcaag
gatgaagctacagcgttagagtataaaacggcgttgctcaatttgctagagaaatga

DBGET integrated database retrieval system