KEGG   Helicobacter pylori 52: HPKB_1213Help
Entry
HPKB_1213         CDS       T01898                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hpz  Helicobacter pylori 52
Pathway
hpz00260  Glycine, serine and threonine metabolism
hpz00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hpz01100  Metabolic pathways
hpz01110  Biosynthesis of secondary metabolites
hpz01130  Biosynthesis of antibiotics
hpz01230  Biosynthesis of amino acids
Module
hpz_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hpz00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HPKB_1213 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HPKB_1213 (trpA)
Enzymes [BR:hpz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HPKB_1213 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB ThiG
Motif
Other DBs
NCBI-ProteinID: ACX99760
UniProt: D0K0Z0
Position
complement(1279253..1280041)
Genome map
AA seq 262 aa AA seqDB search
MRYKNMFEALKKQEKMAFIPFVTLGDPNYEWSFEIIKTLIASGVSALELGFAFSDPVADG
VTIQASHLRALKHASMAKNFQLLRAIRDYNPHIPIGLLAYANLIFSYGVDNFYAQIKECG
VDSILIADMPLIEKELVLKSAQKHQIKQIFIASPNASDKDLEQTAMHSQGYIYTLARSGV
TGASRILENDASAIIKTLKTFSPTPALLGFGISKKEHIKNAKNMGADGVICGSALVKIIE
ENLNDENAMLEKIKGFVGEMIF
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaggtataaaaacatgtttgaagccttaaaaaaacaagaaaaaatggcgtttatcccg
tttgtaaccttgggcgatcctaattatgaatggagttttgaaatcattaaaaccttaatt
gctagcggggtgagcgctttagagttggggtttgctttctccgatccggtagcggatggc
gttaccatacaagcgagccatttaagagcgttaaaacacgctagcatggctaaaaatttt
cagcttttaagagcgatcagagattacaatccccacattcccatagggcttttagcgtat
gcgaatctcattttttcttatggcgtggataatttttacgcccaaatcaaagaatgcggt
gtggatagcattttaatagcggatatgcccctaatagaaaaagaattagtcctaaaatcc
gctcaaaaacaccagattaaacaaatctttatcgccagccccaatgcgagtgataaagat
ttagaacaaaccgctatgcattcgcaaggctatatctacactctggctaggagtggggtt
acaggggcgagccgtattttagaaaatgacgcgagcgctattattaaaaccttaaaaact
tttagccccacaccggccttactaggctttggcatttctaaaaaagaacacatcaaaaac
gctaaaaacatgggcgctgatggcgtgatttgcggctcagcgttagtcaaaatcatagaa
gaaaatttgaacgatgaaaacgccatgctggaaaaaattaaagggtttgtgggagaaatg
attttttaa

DBGET integrated database retrieval system