KEGG   Helicobacter pylori 52: HPKB_1363Help
Entry
HPKB_1363         CDS       T01898                                 

Gene name
ccpA
Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
hpz  Helicobacter pylori 52
Brite
Enzymes [BR:hpz01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     HPKB_1363 (ccpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1411045..1412097
Genome map
AA seq 350 aa AA seqDB search
MKKSVLLGVCLAFSCAHAMNDLELIKKARESQLEPMPMGKALKEYQIKKTKDVGIGTKNS
EIMTPAQVELGKMLYFDPRISTSYLVSCNTCHNLGLGGVDLIPSAVGSQWKKNPHLLSSP
TVYNSVFNDVQFWDGRVTHLNEQAQGPIQSSFEMGADPKVVVEKINSMPGYVKLFRKAYG
TKVKIDFKLIADSIAMFEATLITPSRYDDFLRGNPKALSKAEKEGLDLFISKGCVACHNG
INLGGTMQPFGVVKPYKFANVGDFKGDKNGLVKVPTLRNITETMPYFHNGQFWDVKDAIK
EMGSIQLGIEISDEEAKKIETFFEALKGKKPKILYPELPIITDKTPKPSF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatccgttttattgggcgtttgtttggctttttcttgcgctcatgccatgaac
gatttagaattgatcaaaaaagcgagggaaagccaattagagcctatgcctatgggcaaa
gcgctcaaagaataccagattaaaaaaaccaaagatgtgggtattggcaccaaaaacagc
gagattatgacccccgctcaagtggaattgggcaaaatgctctattttgaccctaggatt
tccacttcctatctcgtgtcttgcaacacatgccataatctgggcttaggcggggtggat
ttaatcccaagcgctgtgggttctcaatggaagaaaaacccccaccttttaagctcccca
acggtgtataactctgtgtttaacgatgtgcagttttgggatgggagggttacgcattta
aacgaacaagcgcaagggcccatccagtcttcttttgaaatgggggctgatcctaaagtg
gtggtagaaaaaatcaattccatgccaggttatgtcaaactctttagaaaagcttatggc
actaaagtcaaaattgattttaaattgatcgcagatagtatcgctatgtttgaagccacg
cttatcaccccaagccgttatgatgattttttaagaggcaatcctaaagcgctcagtaaa
gccgaaaaagaagggctggatttattcatttctaaaggctgtgtggcttgccataacggc
attaatcttgggggaacgatgcagccttttggggtggtcaaaccttataaattcgctaat
gtgggcgatttcaaaggcgataaaaacgggcttgtgaaagtgcctactttaaggaatatc
accgaaacgatgccttatttccataacgggcaattttgggatgtcaaggatgcgattaaa
gaaatgggctctatccagttaggcattgaaatcagcgatgaagaagcgaaaaaaattgaa
actttctttgaagccttaaagggtaaaaaacctaaaatactctatccagaactccctata
ataacagacaaaaccccaaaaccctctttttga

DBGET integrated database retrieval system