KEGG   Helicobacter pylori 52: HPKB_1441Help
Entry
HPKB_1441         CDS       T01898                                 

Gene name
rocF
Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
hpz  Helicobacter pylori 52
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HPKB_1441 (rocF)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    HPKB_1441 (rocF)
Enzymes [BR:hpz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     HPKB_1441 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1501704..1502672)
Genome map
AA seq 322 aa AA seqDB search
MILVGLEAELGASKRGTDKGVRRLREALSATHGDVIKGMQTIIQERCVLYKEFRYAKNFE
DYYLFCKENLIPCMKEVFEKKEFPLILSSEHANMFGIFQAFRSVHKDKKIGILYLDAHAD
IHTAYDSDSKHIHGMPLGMVLNRVRSGFNRMSESEEKAWQKLCSLGLEKGGLEIDPKCLV
YFGVRSTEQSERDVIKELQIPLFSVEAIRENMQEVVQKTKELLKAVDIIYLSLDLDIMDG
KLFTSTGVRENNGLSFNELKQLLGLLLESFKDRLRAVEVTEYNPTVSAKHTNEEERQVLE
ILDLIINSCKVKDKKPSFIMSR
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgattttagtaggattggaagcggaattaggagcgtcaaaaagaggcaccgataaaggg
gttagacgtttgagagaagctttaagcgcaacgcatggcgatgtgattaaaggcatgcaa
acgattattcaagagcggtgcgtgctttataaagagtttagatacgctaagaattttgaa
gattactaccttttttgtaaagaaaatttgatcccttgcatgaaagaagtgtttgagaaa
aaagaatttcctttgattttaagctcagagcatgcgaacatgtttgggattttccaagcc
tttaggagcgttcataaggataaaaaaatagggattttgtatttagatgcgcatgcggat
attcatacggcttatgacagcgattcaaagcatatccacggcatgcctttaggcatggtt
ttaaatcgtgtccgtagcgggtttaatcgcatgagcgagagcgaagaaaaggcatggcaa
aagctttgctctttggggttagaaaagggaggattagaaattgatcctaagtgtttggtg
tattttggggtaagaagcaccgaacagagcgaaagggatgtgattaaagaattgcaaatc
cctttatttagcgtggaagcgataagagaaaacatgcaagaagtggttcaaaaaaccaaa
gaattattaaaagcggtggacattatttatctcagtttggatttagacattatggatggc
aagcttttcacttctaccggcgtgcgtgaaaataacgggctgagttttaatgagctaaaa
caattactgggcttacttttagaaagctttaaagacagattaagagccgttgaagtaacc
gaatacaaccccacggtgagcgcaaaacacaccaacgaagaagaaaggcaggttttagag
atattagatctcatcatcaatagctgtaaagttaaagataagaagccatcttttataatg
agtcgctga

DBGET integrated database retrieval system