KEGG   Helobdella robusta: HELRODRAFT_165792Help
Entry
HELRODRAFT_165792 CDS       T03272                                 

Definition
(RefSeq) hypothetical protein
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
hro  Helobdella robusta
Pathway
Glycerolipid metabolism
Metabolic pathways
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:hro00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    HELRODRAFT_165792
Enzymes [BR:hro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     HELRODRAFT_165792
Peptidases [BR:hro01002]
 Serine Peptidases
  Family S33
   HELRODRAFT_165792
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 245 aa AA seqDB search
MFLRHLVFIAHGAAHHCQCFDEIATKLAQLNNYVFAHDHIGHGRSEGRRMQVDDFSIYLD
DVMNHIERVKKDFKDVPCFILGYSMGGTMAILSSLRFPDVIKGMVLIAPPFNVNSIISKY
KLLLYKTICPRAYVINFDFEFMIKDAEELKKYKEDELIWKGKFTARFLNCARKAFEASMV
KEIKCPYLLMHGSNDVACNIEESQKFFDLSSSEDKTFKRYEGGYHQLFTEGEDVISDIIQ
WINNR
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgtttctcagacatttggtgtttatagcccatggcgcggcccaccactgccaatgtttc
gacgaaattgctaccaaactcgcccaacttaacaactacgtgtttgcccacgatcatatt
ggacacggcaggagcgagggtcgcagaatgcaggttgacgatttttctatttacctcgat
gatgttatgaaccacattgaaagagtcaaaaaagatttcaaggatgttccatgcttcata
ttaggatattccatgggaggaacgatggccatcctatcatcgttgaggtttccagatgtc
atcaaagggatggttctgattgcaccaccattcaatgttaattcaatcatctcaaaatat
aagctcttgttgtacaaaacgatttgtccccgagcttatgttattaattttgattttgag
tttatgatcaaagatgcggaagagcttaagaaatacaaagaagatgaattgatttggaaa
ggtaaattcacagctagatttttgaattgtgctaggaaagccttcgaggctagcatggtg
aaagaaataaaatgtccttatctcctgatgcatggaagcaatgatgtggcgtgtaacatt
gaggaatcgcaaaagttttttgatctttcttcctctgaagataaaactttcaagagatac
gaaggagggtaccatcagttgttcactgaaggagaagacgtcatcagtgacatcattcag
tggatcaacaacagatga

DBGET integrated database retrieval system