KEGG   Halovivax ruber: Halru_0405Help
Entry
Halru_0405        CDS       T02402                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hru  Halovivax ruber
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hru00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Halru_0405
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Halru_0405
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Halru_0405
Enzymes [BR:hru01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Halru_0405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
432055..433320
Genome map
AA seq 421 aa AA seqDB search
MDLSLTADPPSAPTAAREGVWLACIECGEASPPFDAIRYTCDDCGGLLEVRYAEPVGFDA
FAGEGVWRYADALPLDSGVTIQEGGTPLYRVPELTDDVGVETLRIKHEGMNPTGSFKDRG
MTVGVAVARELGVERLACASTGNTSAALSAYGSRAGMETLVLLPAGKVAAGKVAQASLHG
ARILEVDGNFDACLDLVQELAARGEAYLLNSLNPFRLEGQKTIGLEILERFRADHGTVPD
RIVLPVGNAGNTAALYKAFRELVQAGDLAVDDVPKLTGVQAAGAAPMVEAIEAGADAVRR
WDDVETRATAIRIGNPVNAPKALPGIRETGGTAVAVSDAAITDAQRALAGAGIGVEPASA
ASLAGLRKLREDGVVGSEEDVVCLTTGHLLKDPDAAAAAGTEPEPVPDDLDGVLSHLDDR
T
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggatctctcgctgactgccgacccgccctcggccccgacggccgctcgcgagggcgtc
tggctcgcctgcatcgagtgcggtgaagcgtcaccgccgttcgacgcgattcgatacacc
tgcgacgactgtggtggcctcctcgaggtgcggtacgccgagccggtcgggttcgacgcg
ttcgcgggcgagggcgtctggcgctacgcggatgccctcccgctcgacagcggcgtgacg
attcaggagggcgggaccccgttgtaccgcgttccggagctgacggacgacgtcggcgtc
gagacgctgcgaatcaaacacgaggggatgaacccgactggatcgttcaaagatcggggg
atgaccgtcggcgtcgcggtcgcgcgcgaactcggcgtcgagcggcttgcctgcgcctcg
acgggcaacacgagcgccgccctctcggcgtacggctcccgggccgggatggagacgctc
gtcctgctcccggctggcaaggtcgcggcgggaaaggtcgcgcaggcgagcctccacggg
gcgcgtatcctcgaagtcgacggcaacttcgacgcctgtctcgacctcgtccaggaactt
gccgctcgcggcgaggcctacctgctcaactcactcaacccgttccgcctcgagggccag
aagacgatcgggctcgaaatcctcgaacggttccgcgccgaccacggcacggttcccgac
cgaatcgttttgcccgtcggcaacgccggcaacaccgccgcgctgtacaaagcgttccgc
gaactcgtgcaggcgggcgacctcgccgtcgacgacgtgccgaaactcaccggcgtgcag
gccgcgggcgccgccccgatggtcgaggcgatcgaagccggcgccgacgcggtgcgtcgc
tgggacgacgtcgagacgcgcgccacggcgatccggatcggcaaccccgtcaacgcgccg
aaggccctgccagggatccgcgagacgggtgggactgcggtcgccgtctcggacgccgcg
atcaccgacgcccagcgcgccctcgctggagcgggaatcggcgtcgaacccgcctcggcc
gcctcgctcgccggcctgcggaaactccgcgaagacggcgtcgtcgggagcgaggaggac
gtggtctgtctcaccaccggccatctcctcaaggaccccgacgctgcggccgcagcaggg
accgaaccggaacccgttcccgacgatctcgacggcgtgctctcgcacctcgacgacaga
acgtag

DBGET integrated database retrieval system