KEGG   Halovivax ruber: Halru_0405Help
Entry
Halru_0405        CDS       T02402                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hru  Halovivax ruber
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hru01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:hru00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:hru00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
432055..433320
Genome map
AA seq 421 aa AA seqDB search
MDLSLTADPPSAPTAAREGVWLACIECGEASPPFDAIRYTCDDCGGLLEVRYAEPVGFDA
FAGEGVWRYADALPLDSGVTIQEGGTPLYRVPELTDDVGVETLRIKHEGMNPTGSFKDRG
MTVGVAVARELGVERLACASTGNTSAALSAYGSRAGMETLVLLPAGKVAAGKVAQASLHG
ARILEVDGNFDACLDLVQELAARGEAYLLNSLNPFRLEGQKTIGLEILERFRADHGTVPD
RIVLPVGNAGNTAALYKAFRELVQAGDLAVDDVPKLTGVQAAGAAPMVEAIEAGADAVRR
WDDVETRATAIRIGNPVNAPKALPGIRETGGTAVAVSDAAITDAQRALAGAGIGVEPASA
ASLAGLRKLREDGVVGSEEDVVCLTTGHLLKDPDAAAAAGTEPEPVPDDLDGVLSHLDDR
T
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggatctctcgctgactgccgacccgccctcggccccgacggccgctcgcgagggcgtc
tggctcgcctgcatcgagtgcggtgaagcgtcaccgccgttcgacgcgattcgatacacc
tgcgacgactgtggtggcctcctcgaggtgcggtacgccgagccggtcgggttcgacgcg
ttcgcgggcgagggcgtctggcgctacgcggatgccctcccgctcgacagcggcgtgacg
attcaggagggcgggaccccgttgtaccgcgttccggagctgacggacgacgtcggcgtc
gagacgctgcgaatcaaacacgaggggatgaacccgactggatcgttcaaagatcggggg
atgaccgtcggcgtcgcggtcgcgcgcgaactcggcgtcgagcggcttgcctgcgcctcg
acgggcaacacgagcgccgccctctcggcgtacggctcccgggccgggatggagacgctc
gtcctgctcccggctggcaaggtcgcggcgggaaaggtcgcgcaggcgagcctccacggg
gcgcgtatcctcgaagtcgacggcaacttcgacgcctgtctcgacctcgtccaggaactt
gccgctcgcggcgaggcctacctgctcaactcactcaacccgttccgcctcgagggccag
aagacgatcgggctcgaaatcctcgaacggttccgcgccgaccacggcacggttcccgac
cgaatcgttttgcccgtcggcaacgccggcaacaccgccgcgctgtacaaagcgttccgc
gaactcgtgcaggcgggcgacctcgccgtcgacgacgtgccgaaactcaccggcgtgcag
gccgcgggcgccgccccgatggtcgaggcgatcgaagccggcgccgacgcggtgcgtcgc
tgggacgacgtcgagacgcgcgccacggcgatccggatcggcaaccccgtcaacgcgccg
aaggccctgccagggatccgcgagacgggtgggactgcggtcgccgtctcggacgccgcg
atcaccgacgcccagcgcgccctcgctggagcgggaatcggcgtcgaacccgcctcggcc
gcctcgctcgccggcctgcggaaactccgcgaagacggcgtcgtcgggagcgaggaggac
gtggtctgtctcaccaccggccatctcctcaaggaccccgacgctgcggccgcagcaggg
accgaaccggaacccgttcccgacgatctcgacggcgtgctctcgcacctcgacgacaga
acgtag

DBGET integrated database retrieval system