KEGG   Halovivax ruber: Halru_0453Help
Entry
Halru_0453        CDS       T02402                                 

Definition
protein-L-isoaspartate carboxylmethyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
hru  Halovivax ruber
Brite
Enzymes [BR:hru01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Halru_0453
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
481685..482413
Genome map
AA seq 242 aa AA seqDB search
MDRAVLREDMIDSLQHEPKDVLADEAVAVAMSDVPRHEFLPASADAYADRSYECEGTRAL
SPSEAARLVQGLDPAPGDSVLVVGVGVGYTAALLAELVGEEHVHAVDISRPIVSLARSNL
ASAGYGGVLVDRRDGSYGLPEYAPFDRILLEAAAVDAPMALTEQLADGGRLVYPRGATSQ
RLVAVTDDGRTDLGPVSFAPILVEGEQSGALERNRTAREDLEHAVRRTERRRGWELDWID
WE
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atggatcgtgccgtcctccgggaggacatgatcgacagcctccagcacgagccgaaggac
gtcctcgctgacgaggcggtcgccgtcgcgatgagcgacgtccctcgccacgagttcctc
ccagcgtcggccgacgcgtacgctgaccgatcgtacgagtgtgagggaacgcgagccctc
tctccgagtgaggcggcacgcctcgtccaggggctcgacccggcgccgggcgactccgtg
ctggtcgtgggtgtcggcgtcggttacaccgctgcgctcctggcggaactggtcggcgag
gagcacgttcacgcggtcgacatctctcgaccgatcgtttccctggcccgatcgaacctc
gcgagcgccgggtacgggggcgtcctcgtcgatcgtcgtgacggatcgtacgggctcccg
gagtacgcaccgttcgaccgcattctcctcgaagcggcggccgtcgatgcaccgatggcg
ttgaccgaacagctggccgacggcggccggttggtctatccgcgtggtgcgacgagtcag
cgcctcgtcgccgtcaccgacgacggtcgcaccgatctgggacccgtgtcgttcgcgccg
atcctcgtcgagggcgaacagtccggtgcgttagaacggaatcgaaccgcccgggaggac
ttagaacacgccgttcggcgcacagaacgccgtcgtggctgggaactcgactggatcgac
tgggagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system