KEGG   Halovivax ruber: Halru_1086Help
Entry
Halru_1086        CDS       T02402                                 

Definition
peptidase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
hru  Halovivax ruber
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hru00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Halru_1086
Enzymes [BR:hru01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Halru_1086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1115636..1116703)
Genome map
AA seq 355 aa AA seqDB search
MPTHSLDEAMITELTETSGVPGYEDRVRTLVQDAFDESVDRVRTDAMGNVVGTIDGSGDH
EVAVAAHMDEIGFMVSHIESDEDGSGFLELDPLGGWDPRVLKAQRVTVHTEDGDLPGVIG
SPPPHTMDAEEREATPDVDDVYIDLGLPAEDVEDRVAVGDLVTMDQSTETVGELLTGKAM
DDRICLYAMLQTAAAIEDPDATIHFCATVQEEVGLRGARALGVDVDPDLAIAMDVTVAND
VPEFDEGEHVTRLGDGTAIKLKDGSVITSPKVHRRFKSIAEDEEIDYQLEVLPAGGTDTA
GFQHTHGAKPVGALSIPNRYMHTVTEAVHRDDVAATVDLLTAFLEREDGTVDYTL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgccaacgcattctctcgacgaggcgatgatcaccgagctcaccgagaccagcggcgtc
cctggctacgaagatcgcgtacggacactcgtccaggatgcgttcgacgagtcggtcgac
cgggtccgaacggacgcgatgggaaacgtcgtcggcacgatcgacggttcgggcgaccac
gaggtcgccgtcgcggcccacatggacgagatcgggttcatggtcagccacatcgagagt
gacgaggatggcagtggatttctcgaactcgatcccctgggcggctgggaccctcgtgtt
ctcaaagcccagcgcgtgacggtccacaccgaagacggcgaccttccgggcgtcatcggc
tcaccaccaccgcacacgatggacgccgaggagcgcgaggccaccccggacgtcgacgac
gtctacatcgatctcggactccccgccgaagacgtcgaagatcgcgtcgcagtcggcgac
ctcgtcacgatggatcaatcgacggagaccgtcggcgagttgctcaccgggaaggcgatg
gacgaccggatctgtctctacgccatgcttcagacggccgcagcgatcgaagaccccgac
gccacgatccacttctgtgcgaccgtccaggaggaggtcggcctccgcggcgcacgggca
ctcggtgtcgacgtcgatccggacctggcgatcgcgatggacgtgacggtcgcgaacgac
gttccggagttcgacgagggcgagcacgtcacccgactcggcgacggaaccgcgatcaag
ctcaaggacggcagcgtcatcaccagcccgaaagtacaccggcgattcaaatccatcgcc
gaggacgaggagatcgactaccagctcgaagtgcttcccgccggcgggacggacacggcc
ggcttccagcacacccacggcgcaaaaccggttggcgcgctctcgattccgaaccggtac
atgcacaccgtcaccgaagccgtccaccgcgacgacgtggcagcgacggtcgacctgctg
acggccttcctcgaacgcgaggacggaacggtcgactacacgttgtag

DBGET integrated database retrieval system