KEGG   Halovivax ruber: Halru_1086Help
Entry
Halru_1086        CDS       T02402                                 

Definition
(GenBank) peptidase family protein
Organism
hru  Halovivax ruber
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1115636..1116703)
Genome map
AA seq 355 aa AA seqDB search
MPTHSLDEAMITELTETSGVPGYEDRVRTLVQDAFDESVDRVRTDAMGNVVGTIDGSGDH
EVAVAAHMDEIGFMVSHIESDEDGSGFLELDPLGGWDPRVLKAQRVTVHTEDGDLPGVIG
SPPPHTMDAEEREATPDVDDVYIDLGLPAEDVEDRVAVGDLVTMDQSTETVGELLTGKAM
DDRICLYAMLQTAAAIEDPDATIHFCATVQEEVGLRGARALGVDVDPDLAIAMDVTVAND
VPEFDEGEHVTRLGDGTAIKLKDGSVITSPKVHRRFKSIAEDEEIDYQLEVLPAGGTDTA
GFQHTHGAKPVGALSIPNRYMHTVTEAVHRDDVAATVDLLTAFLEREDGTVDYTL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgccaacgcattctctcgacgaggcgatgatcaccgagctcaccgagaccagcggcgtc
cctggctacgaagatcgcgtacggacactcgtccaggatgcgttcgacgagtcggtcgac
cgggtccgaacggacgcgatgggaaacgtcgtcggcacgatcgacggttcgggcgaccac
gaggtcgccgtcgcggcccacatggacgagatcgggttcatggtcagccacatcgagagt
gacgaggatggcagtggatttctcgaactcgatcccctgggcggctgggaccctcgtgtt
ctcaaagcccagcgcgtgacggtccacaccgaagacggcgaccttccgggcgtcatcggc
tcaccaccaccgcacacgatggacgccgaggagcgcgaggccaccccggacgtcgacgac
gtctacatcgatctcggactccccgccgaagacgtcgaagatcgcgtcgcagtcggcgac
ctcgtcacgatggatcaatcgacggagaccgtcggcgagttgctcaccgggaaggcgatg
gacgaccggatctgtctctacgccatgcttcagacggccgcagcgatcgaagaccccgac
gccacgatccacttctgtgcgaccgtccaggaggaggtcggcctccgcggcgcacgggca
ctcggtgtcgacgtcgatccggacctggcgatcgcgatggacgtgacggtcgcgaacgac
gttccggagttcgacgagggcgagcacgtcacccgactcggcgacggaaccgcgatcaag
ctcaaggacggcagcgtcatcaccagcccgaaagtacaccggcgattcaaatccatcgcc
gaggacgaggagatcgactaccagctcgaagtgcttcccgccggcgggacggacacggcc
ggcttccagcacacccacggcgcaaaaccggttggcgcgctctcgattccgaaccggtac
atgcacaccgtcaccgaagccgtccaccgcgacgacgtggcagcgacggtcgacctgctg
acggccttcctcgaacgcgaggacggaacggtcgactacacgttgtag

DBGET integrated database retrieval system