KEGG   Halovivax ruber: Halru_1285Help
Entry
Halru_1285        CDS       T02402                                 

Definition
chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
hru  Halovivax ruber
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:hru00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Halru_1285
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Halru_1285
Enzymes [BR:hru01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Halru_1285
Two-component system [BR:hru02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Halru_1285
Bacterial motility proteins [BR:hru02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Halru_1285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1333132..1334346
Genome map
AA seq 404 aa AA seqDB search
MTRVLVVDDSPFIRTVLGEELDEAGYEVDTAPDGTAAVDAVAECDPDVVTMDVEMPGIGG
IEATERIMADTPTPILMLSVHTDDGADASMEALNRGAMAIMEKPDGAGDRTISDLTDELI
ETIDELSAASTSALALAQTTAAAHRSRTRTRTLASGTSEGGTDVSTSGSAAGPAVSPAPP
AVGGRSDAIGAWPDVPIDVPQVPDEPPTIVIGASTGGPRIVEGILGALPEALGARIVVVQ
HMPAGFTERFAARLDRKSEYAVREAGVSDHIGAGEVVVAPGSAHLEVSSASTDTVEIERS
TAPRVHGVRPSIDVTMESLAATRPPNLVGIVCSGMGRDGARGIEAIHEAGGHTLAQDEAT
SPVFGIPKQAIETGAVDEIVPATSLPARIVARAIATNADDRGDL
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgagtactggtcgtcgacgattcaccgttcatcagaaccgtcctcggtgaggaa
ctcgacgaagcggggtacgaggtcgataccgctccagatggcactgcagcggtcgatgcc
gtggccgagtgtgaccccgacgtcgtcacgatggacgtcgaaatgcccggtatcggtggc
atcgaagccacggaacgaatcatggccgataccccaactccaattctcatgttgagtgtt
cacacggatgacggggccgacgcttcgatggaggcgttgaaccgtggcgcgatggcgatc
atggagaaaccggacggggccggcgatcggacgatctcggacctcaccgacgaactgatc
gaaaccatcgacgagctgtccgcggccagtacctccgcgctcgcgctcgcacagacgacg
gctgccgcccaccggtctcgaacgcggacgcggacacttgcgtcgggaacctcggagggc
ggaacggacgtctcgacgagcggatcggccgctggtccggcggtctctccagcccctccg
gcagtgggtggtcgttcggacgccatcggtgcgtggccggatgtcccgatcgacgtgcca
caggtcccggacgagccaccgacgattgtcatcggcgcgtcgacgggcgggccgcgaatc
gtcgaaggaatactcggagcacttcccgaagcgctcggggctcgcatcgtcgtcgtccag
cacatgcctgctggattcacggaacgctttgccgctcgactcgatcggaagagcgagtac
gcagtccgggaggccggcgtgtccgaccatatcggcgcaggcgaggttgtcgtcgctccc
ggaagtgcacatctcgaggtatccagtgcttcgacggacaccgtcgagatcgaacggtcg
actgcaccacgcgttcacggggtgcgtccctcgatcgacgtgacgatggagtcgctcgcc
gcgacccgaccgccaaatctcgtcggtatcgtctgctctggcatgggtcgagacggtgca
cgcggtatcgaagcgatacacgaagccggcggccacacgctggcacaggacgaagccacg
agtcctgtcttcggaatcccgaaacaggcgatcgaaaccggggccgtcgacgagatcgtc
cccgcgacgtcgcttccggcccgtatcgtggcgagggcgatagcgacgaacgctgacgat
agaggtgatctgtga

DBGET integrated database retrieval system