KEGG   Halovivax ruber: Halru_1306Help
Entry
Halru_1306        CDS       T02402                                 

Definition
succinate dehydrogenase, hydrophobic anchor subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
hru  Halovivax ruber
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:hru00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Halru_1306
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Halru_1306
   00650 Butanoate metabolism
    Halru_1306
  Energy metabolism
   00190 Oxidative phosphorylation
    Halru_1306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1357185..1357550)
Genome map
AA seq 121 aa AA seqDB search
MAERYSSFTPGGTGWLLQRVTAAFLVVTLAFHFFLLHFVNHAYEITFAGTQMRMENIGYL
ITMVLFLWAAAFHGVNGVYNALVNQGLSGTPKRIVLAILSLAGLALVAQGTYVALVMNGM
I
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggccgaacgctactccagtttcacccccggcggcaccggctggctgctccagcgcgtg
accgctgcgttcctcgtggtgacactcgcgtttcacttcttcctgcttcacttcgtcaac
cacgcctacgagatcacgttcgctggcacgcagatgcgcatggagaacatagggtacctg
atcacgatggttctcttcctctgggcagccgcgttccacggggtcaacggcgtctacaat
gcgctcgtcaaccagggactctccgggacgccaaagcgaatcgtactggcgatactgagt
ctcgccggcttggcgctggtcgcacagggaacctacgtggcactcgtcatgaacggaatg
atataa

DBGET integrated database retrieval system