KEGG   Halovivax ruber: Halru_1306Help
Entry
Halru_1306        CDS       T02402                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic anchor subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
hru  Halovivax ruber
Pathway
hru00020  Citrate cycle (TCA cycle)
hru00190  Oxidative phosphorylation
hru00650  Butanoate metabolism
hru00720  Carbon fixation pathways in prokaryotes
hru01100  Metabolic pathways
hru01110  Biosynthesis of secondary metabolites
hru01120  Microbial metabolism in diverse environments
hru01130  Biosynthesis of antibiotics
hru01200  Carbon metabolism
Module
hru_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hru_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hru_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:hru00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Halru_1306
   00650 Butanoate metabolism
    Halru_1306
  Energy metabolism
   00190 Oxidative phosphorylation
    Halru_1306
   00720 Carbon fixation pathways in prokaryotes
    Halru_1306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: AGB15919
UniProt: L0IAZ8
Position
complement(1357185..1357550)
Genome map
AA seq 121 aa AA seqDB search
MAERYSSFTPGGTGWLLQRVTAAFLVVTLAFHFFLLHFVNHAYEITFAGTQMRMENIGYL
ITMVLFLWAAAFHGVNGVYNALVNQGLSGTPKRIVLAILSLAGLALVAQGTYVALVMNGM
I
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggccgaacgctactccagtttcacccccggcggcaccggctggctgctccagcgcgtg
accgctgcgttcctcgtggtgacactcgcgtttcacttcttcctgcttcacttcgtcaac
cacgcctacgagatcacgttcgctggcacgcagatgcgcatggagaacatagggtacctg
atcacgatggttctcttcctctgggcagccgcgttccacggggtcaacggcgtctacaat
gcgctcgtcaaccagggactctccgggacgccaaagcgaatcgtactggcgatactgagt
ctcgccggcttggcgctggtcgcacagggaacctacgtggcactcgtcatgaacggaatg
atataa

DBGET integrated database retrieval system