KEGG   Halovivax ruber: Halru_1411Help
Entry
Halru_1411        CDS       T02402                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
hru  Halovivax ruber
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hru00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Halru_1411
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Halru_1411
Enzymes [BR:hru01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Halru_1411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1460311..1461228)
Genome map
AA seq 305 aa AA seqDB search
MRHGNILTSKQLSREDIETVLDRANELDGDGSALAGEYSDTLLGLLFFEPSTRTKMSFET
AMKRLGGDVVDMGAVDSSSITKGESLADTVRVIEGYTDAIVLRHPKQGAAKLASEYVDVP
VINAGDGAGHHPTQTLLDLYTIRETAGLDDLTIGIMGDLKYGRTVHSLAYALSNFDTRQH
FISPESLQLPREVVFDLHQEGASLKEHESLDPVLSELDVLYVTRIQRERFPDENEYQKVA
GEYCITAETLDDASDDLTVMHPLPRVDEIAPDVDATEHATYFEQAHNGVPVRMALLDLLL
GEDDE
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgcgacacggcaatattctcacgagcaaacaactatcccgcgaggatatcgaaaccgtc
ctcgaccgtgcaaacgaactggatggggacggatcggcgctcgcgggggagtacagtgat
acgctgctcggcctgctgttcttcgaaccgagtacgcgaacgaagatgagtttcgagacg
gcgatgaagcgtctcggtggggacgtcgtcgatatgggtgccgtcgactcctccagtatc
acgaagggagaaagcctggccgataccgttcgcgtcatcgaaggctacaccgacgccatc
gtgttgcgccacccgaaacagggtgcggcaaaactggcgagtgagtacgtcgacgttccg
gtcatcaacgccggagacggcgctggccaccatccaacacagacgctcctcgatctgtac
acgatcagagaaacggcggggctggacgacctgactatcgggatcatgggcgacctgaag
tacggacggaccgtccactcactcgcatacgccctctcgaacttcgatactcgacagcac
ttcatcagtcccgagagcctgcaactcccgcgagaggtcgtcttcgacctccaccaggaa
ggcgcgtccctgaaagaacacgagtcgctcgacccggtgttgtccgaactcgacgtgctc
tacgtcaccaggatccagcgcgagcgcttccccgacgagaacgagtaccagaaggtcgca
ggcgagtactgcatcaccgccgagacgctcgacgatgctagcgacgatctgacggtgatg
cacccgctcccgcgagtcgacgaaatcgcgccggacgtcgacgccacggagcacgcaacg
tacttcgaacaggctcacaacggcgttccggttcgcatggcgctgttagacctcttgctg
ggtgaggacgatgagtga

DBGET integrated database retrieval system