KEGG   Halovivax ruber: Halru_1449Help
Entry
Halru_1449        CDS       T02402                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
hru  Halovivax ruber
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hru01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:hru00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1502454..1503374
Genome map
AA seq 306 aa AA seqDB search
MSRTVRIIGAPVDYGANRRGVDMGPSAIRYAGLAETLAAAGIEARDDGDLFVPRAEERDP
DAGTLDHENAKFIDEVQRACEHLGDRIEETLAEGEFPLVLGGDHSISIGTMHGASRDADL
GVVWFDAHADLNTPSTSPSGNVHGMPLAAALGYDEFADWDWANAPNVREESVAYVGLRSV
DEKEREAIRDSEMTAFTMADIDERGITAVVEDALAAATEGTDGLHVSLDLDWLDPSAAPG
VGTPVRGGVTYREAHSALEVVAEHAEAHDSLRSMDVVEVNPILDESNETASVATEIVASA
FGKRTI
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgaaccgtacgcattatcggtgccccagtcgattacggggcgaatcggcgcggt
gtggatatggggccgtcggcgatcaggtacgcgggactggctgagacgctggcggctgca
gggatcgaagcgcgagacgacggcgacctcttcgtcccccgcgcggaagaacgggatccg
gatgctggaacgctggatcacgagaacgcaaaattcatcgacgaggtccaacgtgcctgc
gagcacctcggcgatcgcatcgaggaaacacttgcagaaggggagtttccgctcgttctc
ggcggcgatcactcgatttcgatcgggacgatgcacggcgcgtcgcgggacgccgacctg
ggcgtggtctggttcgacgcccacgccgacctgaatacaccgtcgacctcgccaagtgga
aacgtccacgggatgccgctcgcagccgccctcggctacgacgagttcgccgactgggac
tgggcgaacgcaccaaacgtccgggaagagtcggtcgcgtacgtcggccttcggagcgtc
gacgagaaagaacgcgaggcgattcgcgacagcgagatgacggctttcactatggcggac
atcgacgaacgaggaatcacggcggtcgtcgaagacgcgcttgccgccgcgaccgaaggg
accgacggcctgcacgtcagcctcgacctcgactggctcgacccgtcggccgcacctggg
gtcgggacaccggtccgtggcggcgtcacgtaccgcgaggcccactcggcgctcgaggtt
gtcgccgaacacgccgaggcacacgactcgttgcgatcgatggacgtcgtcgaagtgaac
ccgatcttagacgagtcgaacgagaccgcctcggttgcgacggagatcgtcgccagtgcc
ttcggaaagcggactatctaa

DBGET integrated database retrieval system