KEGG   Halovivax ruber: Halru_1449Help
Entry
Halru_1449        CDS       T02402                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
hru  Halovivax ruber
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hru00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Halru_1449
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Halru_1449
Enzymes [BR:hru01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Halru_1449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1502454..1503374
Genome map
AA seq 306 aa AA seqDB search
MSRTVRIIGAPVDYGANRRGVDMGPSAIRYAGLAETLAAAGIEARDDGDLFVPRAEERDP
DAGTLDHENAKFIDEVQRACEHLGDRIEETLAEGEFPLVLGGDHSISIGTMHGASRDADL
GVVWFDAHADLNTPSTSPSGNVHGMPLAAALGYDEFADWDWANAPNVREESVAYVGLRSV
DEKEREAIRDSEMTAFTMADIDERGITAVVEDALAAATEGTDGLHVSLDLDWLDPSAAPG
VGTPVRGGVTYREAHSALEVVAEHAEAHDSLRSMDVVEVNPILDESNETASVATEIVASA
FGKRTI
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgaaccgtacgcattatcggtgccccagtcgattacggggcgaatcggcgcggt
gtggatatggggccgtcggcgatcaggtacgcgggactggctgagacgctggcggctgca
gggatcgaagcgcgagacgacggcgacctcttcgtcccccgcgcggaagaacgggatccg
gatgctggaacgctggatcacgagaacgcaaaattcatcgacgaggtccaacgtgcctgc
gagcacctcggcgatcgcatcgaggaaacacttgcagaaggggagtttccgctcgttctc
ggcggcgatcactcgatttcgatcgggacgatgcacggcgcgtcgcgggacgccgacctg
ggcgtggtctggttcgacgcccacgccgacctgaatacaccgtcgacctcgccaagtgga
aacgtccacgggatgccgctcgcagccgccctcggctacgacgagttcgccgactgggac
tgggcgaacgcaccaaacgtccgggaagagtcggtcgcgtacgtcggccttcggagcgtc
gacgagaaagaacgcgaggcgattcgcgacagcgagatgacggctttcactatggcggac
atcgacgaacgaggaatcacggcggtcgtcgaagacgcgcttgccgccgcgaccgaaggg
accgacggcctgcacgtcagcctcgacctcgactggctcgacccgtcggccgcacctggg
gtcgggacaccggtccgtggcggcgtcacgtaccgcgaggcccactcggcgctcgaggtt
gtcgccgaacacgccgaggcacacgactcgttgcgatcgatggacgtcgtcgaagtgaac
ccgatcttagacgagtcgaacgagaccgcctcggttgcgacggagatcgtcgccagtgcc
ttcggaaagcggactatctaa

DBGET integrated database retrieval system