KEGG   Halovivax ruber: Halru_1481Help
Entry
Halru_1481        CDS       T02402                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
hru  Halovivax ruber
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hru00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Halru_1481
  Amino acid metabolism
   00340 Histidine metabolism
    Halru_1481
Enzymes [BR:hru01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Halru_1481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1535561..1536838
Genome map
AA seq 425 aa AA seqDB search
MTIDVRELADLGPTDRAALFERDAGIDAVRADVKSIVDRVREEGDVAVRSFTEEFDDITV
GNIECTDQCERAWESLPADVTDAIQEAIENVESFHRAQVPADWREAFDDGRELGRRFRPI
DRVGVYVPGGAAAYPSSAIMGIVPAVVAGVDHIAVTTPPADEPNPVTLGAIYAAGADAVY
SVGGAQGIAALAYGTESVDRVQKVVGPGNRWVTAAKAAVRGDVEIDLLAGPSEVLVLADE
TADPELIASELLAQAEHDPNASVVAVTDDEETAAAVTDAIDSQLPERSRSDIIEEALSND
ASGVLLARSMSEAILFAESYAPEHLAILAADDEAILDRIDSAGSVFLGPYTPVAAGDYAS
GTNHVLPTSGGARVTGGLSVDTFLRATTVQRLSRDGLDDLSKTITTLAEAEGLEAHAESV
RRRTD
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcgacgtgcgggaactcgccgatctcgggccgacggaccgggcggcactgttc
gaacgggacgctggaatcgacgccgtccgcgctgacgtcaagtcgatcgtcgatcgggtc
cgggaggaaggcgacgtcgccgtccgctcgttcaccgaggagttcgacgacatcaccgtc
gggaacatcgagtgtaccgaccagtgtgaacgcgcctgggagtcgcttccagccgacgtc
acagacgcgatccaggaagcgatcgagaacgtcgaatcgtttcaccgcgcgcaggtaccg
gcggactggcgcgaggcgttcgacgacgggcgcgaactcggccggcggtttcgaccgatc
gatcgcgtcggggtctacgtccccggcggcgcggccgcgtacccctcgagcgcgatcatg
ggcatcgttccggcggtcgtcgccggcgtcgatcacatcgccgtcacgacgccgcccgca
gatgaaccgaaccccgtcacgctcggggccatttacgcggccggtgcggacgcggtgtac
agcgtcggtggcgcacagggaatcgccgctctcgcgtacggaacggagtccgtcgatcgg
gtgcagaaggtcgtcgggccgggcaatcgctgggtgacggcggcgaaagcagccgtgcgc
ggtgacgtggaaatcgaccttctggcgggaccgagcgaggtgctggtgctggccgatgag
accgctgacccggaactgatcgcgagtgaactactcgcccaggccgaacacgacccgaac
gcgtcagtcgtcgcggtgacagacgacgaagagactgcagcggccgtcaccgatgccatc
gactcacagctccccgagcgaagccggtccgacatcatcgaggaagccctctccaacgac
gccagcggggtcctgctcgcccgctcgatgagcgaggccatcctcttcgccgaatcctac
gcccccgagcacctggccatcctcgcggccgacgacgaggcgatcctcgaccgcatcgat
agcgccgggagcgtcttcctcggtccgtacacgcccgtggccgcgggtgactacgccagc
ggcacgaaccacgttctgccgaccagcggcggggcacgggtgaccggtggcctctcggtc
gacacctttctcagggcgaccaccgtccagcgactgtctcgagacggcctggacgacctc
tcgaagacgatcaccacgctcgcggaggccgaggggctcgaggcacacgccgaaagtgtc
cgtcgtcgaaccgactga

  All links  
No link information was found.   
DBGET integrated database retrieval system