KEGG   Halovivax ruber: Halru_1996Help
Entry
Halru_1996        CDS       T02402                                 

Definition
histone acetyltransferase, ELP3 family
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
hru  Halovivax ruber
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2026847..2028562
Genome map
AA seq 571 aa AA seqDB search
MSTETSDPTETEAFERVCETLVERILSGDVERDDVESAKLQACSEHSAPKVPKNAELLEY
APNEHRETLESVLQRKPVRTASGVSPVAIMTSPERCPHGKCLYCPGGPDSEFSSSQSYTG
QEPAAARGVQNDYDPYGQVTLRLEQLRQIGHPVDKVELILMGGTMTARSHDYQEWFVKRA
LEAMNDYDVEKAPEPAEGVSFAQDPDEYEWRYTEDVIAENETNEIRNIGTTFETKPDWCD
PEQIDRMLDLGGTKVEVGVQTTYERINREMHRGHGIQESIDANRRLRDAAFKVGFHMMPG
QPGMSKEMCLEDFRELFANDDWKPDYLKIYPTLVVRGTATYDWWHRDEYDPLTNDEAADL
VAEIKDMIPRYTRLQRVQRDIPADFIDAGVWKSNLRQLARQRMDEHGWSCDCIRCREVGM
NDAEPETVDLDVMTYEACGGTEHFISIEDFDQDLLIGFCRLRFPNDPVRPELEDAALIRE
LHVYGSEVSVGSEPRSSSDAASGQGPQASDAEGGGQHQHRGYGRRLMERAEALATDAGFS
KLSVISGIGAREYYREKLGYHQDGPYVSKRL
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaccgagacgtccgatccgaccgagacggaggcgttcgagcgggtctgtgagacg
ctggtcgagcggattctctcgggcgatgtcgagcgcgacgacgtcgagtcggcgaaacta
caggcgtgttccgagcactccgcgccgaaggtgccgaagaacgcggaactgctcgagtac
gccccgaacgagcatcgcgagacactcgaatcggtcctgcaacgaaagccggtcaggacg
gcctcgggcgtctcgcccgtcgcgatcatgacctcgcccgagcgctgcccgcacgggaag
tgtctgtactgccccggcggtcccgactcggagttctcctcctcgcaaagttacaccgga
caggaaccagcggcggctcgcggggtccagaacgattacgacccctacggccaggtcacc
ctccgcctggagcagttacgccagatcggccaccccgtcgacaaggtcgagctcattctg
atgggcggaacgatgacagcacggagtcacgactatcaggagtggttcgtcaagcgggcg
ctcgaggcgatgaacgactacgacgtcgagaaagcgcccgagcccgccgagggagtgagc
ttcgcgcaagatcccgacgagtacgagtggcggtacacagaagacgtaatcgccgaaaac
gagacgaacgagatccgtaacatcgggaccacgttcgagaccaagcccgactggtgcgac
ccggagcaaatcgaccgcatgctcgatctcggggggacgaaggtcgaggtgggcgtccag
accacctacgagcgcatcaaccgcgagatgcaccgtggccacggtattcaggagtcgatc
gacgccaaccgccgactgcgcgacgcggcgttcaaggtcgggttccacatgatgcccggc
cagccggggatgagcaaagagatgtgcctcgaggacttccgcgaactcttcgcaaacgac
gactggaagcccgattacctgaagatctacccgacgctcgtcgtccgcggcaccgccacc
tacgactggtggcaccgagacgagtacgaccccctgacgaacgacgaggcggccgacctg
gtcgccgagatcaaggacatgatcccgcgctacacgcgcctccagcgcgtccagcgggac
atccccgcggacttcatcgacgccggcgtctggaagtcgaacctgcgccagctcgccaga
cagcgcatggacgaacacggctggtcctgtgactgtatccggtgtcgcgaagtggggatg
aacgacgcggagcccgaaaccgtcgacctggacgtgatgacctacgaggcctgcggcggc
acggagcacttcatctccatcgaggacttcgaccaggacctcctgatcggcttctgccgg
cttcgcttcccgaacgaccccgttcgcccagaactcgaggatgccgcgttgatccgcgag
cttcacgtctacggcagcgaggtgagcgtcggaagcgagccgcgaagcagctcggacgcc
gcgagcggacagggcccgcaagcgagcgacgcggagggcggcggccagcaccagcaccgg
ggctacggccgtcggctgatggagcgagccgaagcgctcgccaccgacgccggattttct
aagctctcggtgatctccggtatcggcgcccgtgagtactaccgcgagaaactcggctat
caccaggacggcccgtacgtgagcaagcggctctag

DBGET integrated database retrieval system