KEGG   Halovivax ruber: Halru_2104Help
Entry
Halru_2104        CDS       T02402                                 

Definition
theronine dehydrogenase-like Zn-dependent dehydrogenase
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
hru  Halovivax ruber
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:hru01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:hru00680]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:hru00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2144826..2145995
Genome map
AA seq 389 aa AA seqDB search
MPTKAVVYNDAHDVSIEEIDDPTLTSPNDAILEVTQTAICGSDLHMYEGRAGAEPGMAFG
HEIMGEISEVGDGVEQLSPGDRVVLPFNVACGYCRNCEEGHYGYCENVESATPGGAYGYV
KMGSYQGGQAERVRVPYADHNALKIPDDPANGTPEDFIMLADVFPTGWHGVELADLQPGE
SVAIFGAGPVGLMAAYSAHLRGASEIYVVDRVESRLELADEHCNATAINFEERDAVEAIT
DAHGGGVDKGVDAVGYQAIEDGRDGESAYDESRENPSIILNQLIDAVRPTGKIGIVGLYV
SDDPDQPDHIGEQGLLRVHLGTAFEKGLRFGMGQCPVKRYNRRLRDMIIAGEAEPGFVIS
HTTSLDEAPEMYERFDEREEGVTKVLLEP
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
gtgccaacgaaagcagtcgtctacaacgacgcacacgacgtttcgatcgaagagatcgac
gatccaacgctgacgagtccgaacgatgcgatcctggaggtgacgcagacggccatctgt
gggtcggatctgcacatgtacgaggggcgcgccggcgcggagccagggatggcgttcggt
cacgagatcatgggcgagatcagcgaggtcggcgacggcgtcgagcaattgtcaccgggc
gatcgggtcgttcttccgttcaacgtcgcctgcggctactgtcgaaattgcgaggagggt
cactacgggtactgcgagaacgtcgagtcggcgacgccaggtggtgcgtacggctacgtg
aagatgggctcgtaccagggcgggcaggccgagcgcgttcgggtgccctacgccgatcac
aacgcgctgaagattccggacgatcccgccaacggcacgcctgaagacttcatcatgctc
gccgacgtcttccccacgggctggcacggcgtcgaactcgcggacctgcaaccgggtgaa
tccgtcgcgatcttcggcgccggaccggtcggactgatggccgcctacagcgcccacctc
cgcggtgcctccgagatctacgtcgtcgatcgagtggagagtcggctcgaactggccgac
gaacactgcaatgcgacggcgatcaacttcgaagaacgagacgcagtcgaggcgatcacc
gacgcgcatggcggtggtgtcgacaagggcgtcgacgcagttggataccaggccatcgag
gacggtcgcgatggcgagtcggcctacgacgagtcacgggaaaatccctcgatcatcctc
aaccagcttatcgacgcggtccggccgacggggaagattggcatcgtcggcctctacgtc
tccgacgatcccgaccagcccgaccacatcggtgaacagggcctcctgcgcgtccacctc
ggcaccgcgttcgagaagggactccgattcggaatggggcagtgtccggtcaaacggtac
aaccgccgactccgcgacatgatcattgccggagaggccgaacctgggttcgtcatctca
cacacgacgtcgctcgacgaggcgcccgagatgtacgagcggttcgacgaacgcgaagaa
ggtgtgacgaaggtcctgctcgaaccctga

DBGET integrated database retrieval system