KEGG   Halovivax ruber: Halru_2210Help
Entry
Halru_2210        CDS       T02402                                 

Definition
arginase family hydrolase, arginase/agmainase/formiminoglutamate hydrolase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
hru  Halovivax ruber
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hru00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Halru_2210
Enzymes [BR:hru01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Halru_2210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2247698..2248612
Genome map
AA seq 304 aa AA seqDB search
MFPGATDRHDAPDTSGQAESSTDDDPAASEGANFVIVGAPLDASTTFEPGTRFGPRRVRH
FAATFDDYDHRTDQHFSDLGVVDDGDVHAWDDVPAYLEYLAGTLRDVTWDEAVPLAIGGE
HTISLAGARATEPDVFVCLDAHLDLREAYDGNRLSHACVTRRILDAEDIDVEEAIILGAR
TGSEAEWERAAADDVTVVPPESVGGWLDDTDVDALLDGREAYLSVDIDGADPAYAPGTGT
MEPFGLEPREMRDVVRTVAPSATGFDVVEVNDRDDGQAASLAGKLLKEFVYTHAATNGPI
ASTR
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgtttcccggggcgaccgaccgacacgacgcacccgacacgagcggccaggcggagtcg
tcgaccgacgacgacccggccgcgagcgagggcgcgaacttcgtgatcgtcggcgcgccc
ctggacgcgtcgacgacattcgaaccggggacccgattcggcccccggcgcgtgcgacat
tttgcggcaacgttcgacgattacgatcaccggacggaccagcacttttccgacctcggc
gtcgtcgacgacggcgacgtccacgcctgggacgacgtgccggcctacctcgaatacctc
gcgggaacgcttcgcgacgtcacctgggacgaggcggtcccactcgcgatcggcggcgag
cacacgatctcgctggccggcgcgagggcaaccgaacccgacgtcttcgtctgtctcgac
gcgcacctcgatctgcgcgaggcgtacgacggcaaccggctcagccacgcctgcgtgacc
cgccggatcctcgacgccgaggacatagacgtcgaggaggcgatcatcctgggcgcgcga
accgggagcgaggccgagtgggagcgtgcggcggccgacgacgtcactgtcgtcccgccg
gagtccgtcggcgggtggctggacgacaccgacgtcgacgcgttactcgacggacgggaa
gcctacctcagcgtcgacatcgacggcgccgatccggcgtacgcgcccgggacggggacg
atggagccgttcgggctcgaaccgcgcgagatgcgtgacgtggtccgcacggtcgcgccg
tccgcgacgggcttcgacgtcgtcgaggtcaacgatcgcgacgacgggcaagcggcgtcg
ctcgccggcaagttgctgaaggagttcgtgtacacacacgcggcgaccaacgggccgatc
gcgtcgacgcgataa

DBGET integrated database retrieval system