KEGG   Halovivax ruber: Halru_2300Help
Entry
Halru_2300        CDS       T02402                                 

Definition
Indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hru  Halovivax ruber
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hru00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Halru_2300
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Halru_2300
Enzymes [BR:hru01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Halru_2300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2329253..2330080
Genome map
AA seq 275 aa AA seqDB search
MNDKGLDPAVRSILEAARDRSGRGDERLSVHARSLAAAIERAESDGRVPIVAEVKPTSPT
TDGVRTDDPVELAQQMVDGGATAISVLTEPDHFDGSTAALARVREAVSVPVLRKDFVVRE
EQLDAVEADLVLLIARFVDELDELVSAALDRGLQPIVEVHDRAELRRALATETAVVGINN
RDLASLEVDLTTVERVAAVEDPSLRQALDDVTLVAESGVSTPADVRRMREAGADALLVGS
AIMDGDVAANTRALVNAERAVETDDADTASEVDAA
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacaaaggactcgatccggccgttcggtcgatcctcgaagcggcacgggatcga
tcgggccgtggcgacgagcggctgtcggtacacgctcggtcgctggcggcggcgatcgag
cgggccgagtcggacgggcgcgtcccgatcgtcgcggaggtgaaaccgacgagcccgacg
accgacggcgttcggacggacgaccccgtcgagctcgcacagcagatggtcgacggcggc
gcgaccgcgatttcggtgttgaccgaacccgatcacttcgacgggtcgaccgcggcgctc
gcgcgcgttcgcgaggccgtctcggttcccgtcctccggaaggacttcgtcgtccgtgaa
gagcaactcgacgccgtcgaagcagacctcgtcttgctcatcgcacggttcgtcgacgaa
ctcgacgaactcgtctcggccgcactcgatcgcggcctccagccgatcgtcgaagtccac
gatcgagcggaactacgccgcgcactggcaacggagacggccgtcgtcggcatcaacaat
cgcgacctcgcctcactcgaggtcgatctgacgaccgtcgagcgcgtcgcggctgtcgag
gacccgtcactccgccaggcgctcgacgacgtgaccctggtcgccgagagcggcgtctcg
acgcccgcggacgtccgccggatgcgcgaggccggggccgacgccctgctcgtcgggagc
gccatcatggacggcgacgtggcggcgaacacccgagcgctcgtgaacgcggagcgcgct
gtagaaacggacgatgccgacaccgcatcggaggtggacgctgcgtga

DBGET integrated database retrieval system