KEGG   Halovivax ruber: Halru_2423Help
Entry
Halru_2423        CDS       T02402                                 

Definition
(GenBank) transcriptional regulator/sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
hru  Halovivax ruber
Pathway
hru00010  Glycolysis / Gluconeogenesis
hru00052  Galactose metabolism
hru00500  Starch and sucrose metabolism
hru00520  Amino sugar and nucleotide sugar metabolism
hru00521  Streptomycin biosynthesis
hru01100  Metabolic pathways
hru01110  Biosynthesis of secondary metabolites
hru01120  Microbial metabolism in diverse environments
hru01130  Biosynthesis of antibiotics
hru01200  Carbon metabolism
Module
hru_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:hru00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halru_2423
   00052 Galactose metabolism
    Halru_2423
   00500 Starch and sucrose metabolism
    Halru_2423
   00520 Amino sugar and nucleotide sugar metabolism
    Halru_2423
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Halru_2423
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Halru_2423
Enzymes [BR:hru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Halru_2423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N
Motif
Other DBs
NCBI-ProteinID: AGB17005
UniProt: L0IBR1
Position
complement(2442094..2443074)
Genome map
AA seq 326 aa AA seqDB search
MTYFAGVDLGATNVRAIVGDHAGEPIATSRRRTPQGPTGIDVTEAVLDTLRDACADAGIE
PTAIEDAAIGSIGPFDLAEGAVVDPANLPDSIDRIPLTGPVERLVAVDDVALHNDATAGV
IGERFYAARNPDDMCYVTISSGIGAGICCDGSVLSGWDGNAGEIGHIVVDPDGALTCGCG
RAGHWEAYCSGRGIPTYARELARRSDLETALPLESDEFDAATVFAAADSDPLAARVIDRV
ADWNTIGIATLVHAVAPMVVSIGGAVATNNPELVIDPIRERLQTAVISNVPAVTPATLGE
SVVLRGALASAITDGSGDASAIVVRE
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgacctacttcgcgggcgtcgatctcggcgcgaccaacgtccgtgcgatcgtgggcgac
cacgccggcgagccgatcgcgaccagccgtcggcggacgccgcagggacccaccggaatc
gacgtcacggaagccgtgctggacacccttcgggacgcgtgtgccgacgccgggatcgag
ccaaccgccatcgaagacgccgcgatcggctcgatcgggccgttcgacctcgccgagggg
gccgtggtcgacccggcgaacctgcccgattcgatcgatcgtatcccgctcaccggtccg
gtcgaacggctcgtcgccgtcgacgacgtcgccctgcacaacgacgcgacggcgggtgtc
atcggcgaacgcttctacgccgcgcgaaaccccgacgacatgtgctacgtgacgatctcg
tcggggatcggggccggcatctgctgtgacggctcggtcctctccggatgggacggaaac
gccggcgagatcggccacatcgtcgtcgatcccgatggggcgctcacctgcggttgcggc
cgggcgggccactgggaagcctactgttccggccgcggaatcccaacgtacgcgcgagaa
ctcgcacgtcggtccgacctcgagaccgcccttccactcgaatcggacgagttcgatgcg
gcgaccgtgttcgcggccgccgattccgacccgctcgcagcgcgggtgatcgaccgggtc
gccgactggaacacgatcggcatcgcgacgctggtccacgcggtcgctccgatggtcgtc
tcgatcggcggggccgtcgcgacgaacaacccggaactcgtgatcgacccgatccgggag
cgtctccagacggcggtcatctcgaacgttccagccgtcaccccggccacactcggcgag
tcggtcgtgctccgcggggcactcgccagcgcgatcaccgacgggtcgggcgacgcgtcg
gcgattgttgtccgggaatag

DBGET integrated database retrieval system