KEGG   Halovivax ruber: Halru_2720Help
Entry
Halru_2720        CDS       T02402                                 

Definition
(GenBank) hypothetical protein
  KO
K12234  coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
hru  Halovivax ruber
Pathway
hru00680  Methane metabolism
hru01120  Microbial metabolism in diverse environments
Module
hru_M00378  F420 biosynthesis
Brite
KEGG Orthology (KO) [BR:hru00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Halru_2720
Enzymes [BR:hru01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     Halru_2720
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     Halru_2720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F420_ligase
Motif
Other DBs
NCBI-ProteinID: AGB17295
UniProt: L0ICN4
Position
complement(2745408..2746244)
Genome map
AA seq 278 aa AA seqDB search
MELHPVPDLPEIEPGDDLAAMIAERAAIEPGDVVTVASTVVSKAQGRTADLADFPAGPRA
VELAERFEALTGEAKDPRFAQAVLEESTEIIVETPFMLTETCFGHTCVNAGIDRSNVPEH
DLLLLPKRPADRAAGLRAGLLERADGLDAEAADRIETAGSDGDVPDGIDEVGVVVTDTCG
RPFRHGQRGVALGWAGMPASRDWRGETDRDGRELGVTVQAIVDELASAANLVTGEGDDGT
PAVVVRDFDFGDHAGGASLFRSVEKDQVRQALREWSYE
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggaactacacccggtcccggacctgcccgaaatcgaaccgggggacgacctcgccgcg
atgatcgccgagcgcgccgcgatcgagccgggcgacgtggtcaccgtcgcgagtacggtc
gtctcgaaggcacagggccggacggcggacctcgcagactttccggcgggaccgcgggcc
gtcgaactcgccgagcggttcgaggcgctgacgggcgaggcgaaggatccgcgatttgcc
caggccgtcctcgaagagagtaccgagatcatcgtcgagaccccgttcatgctcacggag
acgtgcttcgggcacacctgcgtcaacgcggggatcgaccgctcgaacgtcccggaacac
gatctgctcttgctcccgaagcgaccggccgaccgcgccgcggggctccgggccggcttg
ctcgaacgcgccgacggactcgacgccgaagcggccgaccgaatcgaaactgcgggcagc
gacggggacgtccccgacggcatcgacgaagtcggcgtcgtcgtcaccgacacctgcggc
cggccgttccgccacggccagcgcggcgtcgccctcggctgggcgggcatgccggccagt
cgggactggcgcggcgagacggatcgcgacgggcgcgaactcggcgtcaccgtccaggcc
atcgtcgacgaactcgcctcggcggccaacctcgtcaccggcgagggcgacgacggcacc
cctgcggtggtcgtgcgcgacttcgactttggcgatcacgccggtggcgcctccctcttc
cgctcggtcgagaaggatcaggtgcgacaggcgctccgggagtggtcgtacgaatga

DBGET integrated database retrieval system