KEGG   Halovivax ruber: Halru_2941Help
Entry
Halru_2941        CDS       T02402                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
hru  Halovivax ruber
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hru00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Halru_2941
Enzymes [BR:hru01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Halru_2941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2968786..2970084
Genome map
AA seq 432 aa AA seqDB search
MTVGVVGAGMSGLALVRAVAQRGEEVIAFEARDEPGGVVQSREVDGRIVELGPQRLRLTP
GLESMIDDYDLRESLRYGADDQPIYVYHDGDLKVAPLSVREAITTDLISPLGKLRMLLEP
LFGPPKPGETVDEFLVRKFGTQAARRYAGPLYSGLYGTDPRDMLMEYSLGRVLEKRGVER
SILLKVLESVRSDRETPPIVSFDDGIGELVDALYEAHADSIHLGTPVEAIRPVDDTNGSD
AAGYELETADGIERVDDVVVTTPAPIAAELLEPVDTDLATALDRFNYNPIGLVFLDADFG
GRGLGTLVPPDADDVSISGLTWNASILDRDRLYTAYLDPLSYPPLLEATEGELGQVAARE
FERITGASAEPIHVHRWEPGMPAYDRTWTAMDDLEPPAGIHLCASYVGRPGIPGRIRNAE
ALAKQLVGGTSE
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcggagtcgtcggcgcggggatgtccggactggcgctcgtgcgagcggtagca
cagcgcggcgaggaggtaatcgcgttcgaggcccgggacgagccggggggcgtcgtccag
agtcgcgaggttgacggccggatcgtcgagctcggcccgcaacggctgcgcctgacgccg
ggcctcgagtcgatgatcgacgactacgacctgcgcgagagcctccggtacggcgccgac
gaccagccgatctacgtctaccacgacggcgacctgaaggtcgcgccgctgtcggtccgc
gaggcgatcacgaccgatctcatcagcccgctgggcaagctccggatgctactcgaaccg
ctgttcggcccgcccaaacccggcgagaccgtcgacgagttcctcgtccggaagttcggg
acgcaggcggctcggcggtacgccggcccgctgtacagcggcctctacggcaccgacccg
cgcgacatgctgatggaatactcgctcgggcgcgtgctcgaaaaacgcggcgtcgagcgc
agcatcctcctgaaagtactcgaatcggttcgatccgaccgcgagacgcccccgatcgtc
tccttcgacgacgggatcggcgaactcgtggacgctctgtacgaggcccacgccgattcg
atccacctggggacgccggtcgaggcgatccggccggtcgacgacacgaacggctccgac
gccgccggctacgaactcgagacggccgacggaatcgagcgcgtcgacgatgtcgtcgtg
acgacgccggcgccgatcgcggccgaactgctcgaaccggtcgacaccgacctcgctacg
gccctcgatcggttcaactacaacccgatcgggctggtctttctcgacgccgacttcggg
ggccggggcctcggcacgctcgtcccgccggacgccgacgacgtctcgatcagcggactg
acctggaacgccagcatcctcgatcgcgaccgcctctacaccgcctacctcgatccgctg
tcgtacccgccgctgctggaggcgaccgagggcgagctcggccaggtcgcggcgcgggag
ttcgagcgcatcaccggcgcatcggcggagccgatccacgtccaccgctgggaaccgggc
atgcccgcctacgaccgcacctggaccgcgatggacgacctcgaacccccagcagggatc
cacctctgcgccagctacgtgggtcgacccgggatccccggccggatccgcaacgccgag
gcgctcgccaagcaactcgtcggcggcacaagcgagtaa

DBGET integrated database retrieval system